JASPAR (http://jaspar.genereg.net) is the leading open-access database of matrix profiles describing the DNA-binding patterns of transcription factors (TFs) and other proteins interacting with DNA in a sequence-specific manner.
http://www.ncbi.nlm.nih.gov/pubmed/19906716
Just a collection of some random cool stuff. PS. Almost 99% of the contents here are not mine and I don't take credit for them, I reference and copy part of the interesting sections.
Wednesday, March 31, 2010
Departures (おくりびと, Okuribito?)
Departures (おくりびと, Okuribito?) is a 2008 Japanese film by Yōjirō Takita. It won the Academy Award for Best Foreign Language Film at the 2009 Oscars and has earned $61,010,217 in Japan as of April 12, 2009.[1]
http://en.wikipedia.org/wiki/Departures_(film)
http://www.imdb.com/title/tt1069238/
http://en.wikipedia.org/wiki/Departures_(film)
http://www.imdb.com/title/tt1069238/
cancer data, plant-pathogen metabolic reconstruction
Targeted metabolic reconstruction: a novel approach for the characterization of plant–pathogen interactions
Andrés Pinzón, Luis M. Rodriguez-R, Andrés González, Adriana Bernal and Silvia Restrepo
Corresponding author. Andrés Pinzón, Laboratorio de Micología y Fitopatología, Universidad de los Andes, Bogotá, Colombia. Tel: +57 1 3394949; ext. 2777; E-mail: am.pinzon196@uniandes.edu.co
http://bib.oxfordjournals.org/cgi/content/abstract/bbq009v1?papetoc
Online resources of cancer data: barriers, benefits and lessons
Emanuela Gadaleta, Nicholas R. Lemoine and Claude Chelala
http://bib.oxfordjournals.org/cgi/content/abstract/bbq010v1?papetoc
- The Cancer Genome Atlas (TCGA) - http://cancergenome.nih.gov
- International Cancer Genome Consortium (ICGC) - http://www.icgc.org/
- BioMart - http://www.biomart.org
- Pancreatic Expression database - http://www.pancreasexpression.org
- Cancer Biomedical Informatics Grid (caBIG) - http://cabig.nci.nih.gov
- The Lymphoma Enterprise Architecture Data-system (LEAD) - http://umlmodelbrowser.nci.nih.gov/umlmodelbrowser/
- Repository of Molecular Brain Neoplasia Data (REMBRANDT) - http://rembrandt.nci.nih.gov
- ONcology Information eXchange (ONIX) - http://www.ncri-onix.org.uk
- Oncomine - http://www.oncomine.org
- ArrayExpress - http://www.ebi.ac.uk/arrayexpressas/ae
- Gene Expression Omnibus - http://www.ncbi.nlm.nih.gov/geo/
Need some link checker to see which links are still alive and dead
BioCyc SAQP - web-based SQL query interface
http://biocyc.org/query.shtml
Andrés Pinzón, Luis M. Rodriguez-R, Andrés González, Adriana Bernal and Silvia Restrepo
Corresponding author. Andrés Pinzón, Laboratorio de Micología y Fitopatología, Universidad de los Andes, Bogotá, Colombia. Tel: +57 1 3394949; ext. 2777; E-mail: am.pinzon196@uniandes.edu.co
http://bib.oxfordjournals.org/cgi/content/abstract/bbq009v1?papetoc
Online resources of cancer data: barriers, benefits and lessons
Emanuela Gadaleta, Nicholas R. Lemoine and Claude Chelala
http://bib.oxfordjournals.org/cgi/content/abstract/bbq010v1?papetoc
- The Cancer Genome Atlas (TCGA) - http://cancergenome.nih.gov
- International Cancer Genome Consortium (ICGC) - http://www.icgc.org/
- BioMart - http://www.biomart.org
- Pancreatic Expression database - http://www.pancreasexpression.org
- Cancer Biomedical Informatics Grid (caBIG) - http://cabig.nci.nih.gov
- The Lymphoma Enterprise Architecture Data-system (LEAD) - http://umlmodelbrowser.nci.nih.gov/umlmodelbrowser/
- Repository of Molecular Brain Neoplasia Data (REMBRANDT) - http://rembrandt.nci.nih.gov
- ONcology Information eXchange (ONIX) - http://www.ncri-onix.org.uk
- Oncomine - http://www.oncomine.org
- ArrayExpress - http://www.ebi.ac.uk/arrayexpressas/ae
- Gene Expression Omnibus - http://www.ncbi.nlm.nih.gov/geo/
Need some link checker to see which links are still alive and dead
BioCyc SAQP - web-based SQL query interface
http://biocyc.org/query.shtml
Tuesday, March 30, 2010
Java don't support multiple inheritance
multiple inheritance, ie. invalid class cat extends animal,feline,fourLegs
but you can still do
class cat extends animal implements feline, fourLegs
http://java.sys-con.com/node/37748
http://csis.pace.edu/~bergin/patterns/multipleinheritance.html
but you can still do
class cat extends animal implements feline, fourLegs
http://java.sys-con.com/node/37748
http://csis.pace.edu/~bergin/patterns/multipleinheritance.html
Monday, March 29, 2010
Bacteria Nitrogen Fixation
- Convert N2 gas to NH4+ ammonium
- symbiotic N2 fixing bacteria lives in the plant root nodules (anaerobic) in poor N2 conditions
- bacterias (eg. leguminous, Rhizobia - symbiotic, cyanobacteria - free living) give plants with fixed N2 and plants give bacterias with nutrients and carbs.
nodules provide anaerobic conditions by:
- low gas permeability
- leghemoglobin
plant gives:
- nodule
- leghemoglobin - oxygen transport
- nutrients
bacteria gives:
- fixed N2 via Nitrogenase enzyme
- heme part of hemoglobin
Nitrogenase rxn:
N2 + 8Fdred + 8H+ + 16 ATP 2NH3 + H2 + 16 ADP + 16Pi
by redox rxn in Fe protein and reducing MoFe (iron-molybdenum) protein.

Rhizobial genes participating in nodule formation
= nodulation (nod) genes
Summary of infection process / Establishing the symbiotic relationship

1. FLAV (flavonoid) is a chemo-attractant that attracts bacterias to secrete Nod D genes.
2. Nod D genes bind to promoter of Nod A,B,C genes
3. Nod factor LCO (LipoChitin Oligosacharides) is expressed
4. LCO binds to lectin receptors in plant root hair
5. bacteria attaches to cell wall of root hair
6. root hair curls due to Nod factors
7. cell wall degrades and bacteria have access to plant plasma membranes
8. Golgi vesicles fuse and extends plasma membrane to form the infection thread towards the root cortex
9. cells deep in root cortex differentiate and divide - initiates nodule formation
10. infection thread branches and moves towards developing nodules
11. bacteria enclosed in plasma membrane are release into nodule
12. bacteria starts to differentiate and divide and becomes bacteroids - N2 fixing symbiont organelles in root epithelial cells
13. nodule elongates and differentiates, including vascular system surrounds bacteroids so it's possible to transfer nutrients and fixed N2
14. layers of cells form to prevent O2 from entering.
15. Nitrogenase enzyme and leghemoglobin are synthesized
- symbiotic N2 fixing bacteria lives in the plant root nodules (anaerobic) in poor N2 conditions
- bacterias (eg. leguminous, Rhizobia - symbiotic, cyanobacteria - free living) give plants with fixed N2 and plants give bacterias with nutrients and carbs.
nodules provide anaerobic conditions by:
- low gas permeability
- leghemoglobin
plant gives:
- nodule
- leghemoglobin - oxygen transport
- nutrients
bacteria gives:
- fixed N2 via Nitrogenase enzyme
- heme part of hemoglobin
Nitrogenase rxn:
N2 + 8Fdred + 8H+ + 16 ATP 2NH3 + H2 + 16 ADP + 16Pi
by redox rxn in Fe protein and reducing MoFe (iron-molybdenum) protein.

Rhizobial genes participating in nodule formation
= nodulation (nod) genes
Summary of infection process / Establishing the symbiotic relationship

1. FLAV (flavonoid) is a chemo-attractant that attracts bacterias to secrete Nod D genes.
2. Nod D genes bind to promoter of Nod A,B,C genes
3. Nod factor LCO (LipoChitin Oligosacharides) is expressed
4. LCO binds to lectin receptors in plant root hair
5. bacteria attaches to cell wall of root hair
6. root hair curls due to Nod factors
7. cell wall degrades and bacteria have access to plant plasma membranes
8. Golgi vesicles fuse and extends plasma membrane to form the infection thread towards the root cortex
9. cells deep in root cortex differentiate and divide - initiates nodule formation
10. infection thread branches and moves towards developing nodules
11. bacteria enclosed in plasma membrane are release into nodule
12. bacteria starts to differentiate and divide and becomes bacteroids - N2 fixing symbiont organelles in root epithelial cells
13. nodule elongates and differentiates, including vascular system surrounds bacteroids so it's possible to transfer nutrients and fixed N2
14. layers of cells form to prevent O2 from entering.
15. Nitrogenase enzyme and leghemoglobin are synthesized
Park Bom::. You And I Lyric
http://fulllyricseng.wordpress.com/2009/10/29/park-bom-you-and-i-lyric/
No matter what happens
Even when the sky is falling down
I’ll promise you
That I’ll never let you go
Oh~~~Oh~~Oh~~~oh~~Oh~~~oh~~Yeah~~~
You naega sseureojilddae
Jeoldae heundeullimeopsi
Ganghan nunbicheuro
Myeotbeonigo nal ileukyeojweo
And you, na himae gyeoulddae
Seulpeumeul byeolang kkeutkkaji ddo akkimeopsi
Chajawa du son japeun geudaeyegae
[Chorus]
Nan haejoongae eopneundae
Chorahan najiman
Oneul geudae wihae i norae booleoyo
Tonight geudaeye du noonae
Geu miso dwiae nalwihae gamchweowatdeon
Apeumiboyeoyo
You and I together
It just feels so right
Ibyuliran maleulhaedo
Geu nuga mweorahaedo nan geudael jikilgae
You and I together
Nae du soneul nochijima
Annyoungiran maleun haedo
Naegae i saesangeun ojik neo hanagiae
You maneun sarangcheoreom
Oori sarang yeokshi jogeumssik byunhagaetjyo
Hajiman jaebal seulpeo malayo
Oraen chinhan chingu cheoreom
Namaneul mideulsuitgae gidaelsuitgae
I promise you that I’ll be right here, baby
[Chorus]
Nan haejoongae eopneundae
Chorahan najiman
Oneul geudae wihae i norae booleoyo
Tonight geudaeye du noonae
Geu miso dwiae nalwihae gamchweowatdeon
Apeumiboyeoyo
You and I together
Nae du soneul nochijima
Annyoungiran maleun haedo
Naegae i saesangeun ojik neo hanagiae
Waeroun bami chajaolddaen
Na salmyeosi nooneul gamayo
Geudaeye soomgyeoli nal aneulddae
Mueotdo duryeopji anjyo
E saesang geu eoddeon nugudo
Geudaereul daeshin halsueopjyo
You are the only one
And I’ll be there for you, baby
You and I together
It just feels so right
Ibyeoliran maleulhaedo
Geu nuga mweorahaedo nan geudael jikilgae
You and I together
Nae du soneul nochijima
Annyoungiran maleunhaedo
Naegae i saesangeun ojik neo hanagiae
Just you and I
Forever and ever
****Translation****
No matter what happens
Even when the sky is falling down
I’ll promise you
That I’ll never let you go
Oh~~~Oh~~Oh~~~oh~~Oh~~~oh~~Yeah~~~
You, When I fell
you held me back up with an unfaltering gaze
And You, through those sad times
held my hands till the end of the world
[Chorus]
I might be a shabby person who has never done anything for you
But today, I am singing this song just for you
Tonight, within those two eyes and a smile
I can see the pains from protecting me
You and I together. It’s just feels so right
Even though i bid you goodbye, to me this world is just you
You and I together, don’t ever let go of my hands
even though i bid you goodbye, to me this world is just you
Our love has changed a bit by bit just like others
But don’t be sad
Hopefully I will be someone who you can trust like an old friend
and someone you can lean onto
I promise you that I’m be right here baby
[Chorus]
I might be a shabby person who has never done anything for you
But today, I am singing this song just for you
Tonight, within those two eyes
and smile I can see the pains from protecting me
You and I together. It’s just feels so right
Even though i bid you goodbye, to me this world is just you
You and I together, don’t ever let go of my hands
even though i bid you goodbye, to me this world is just you
I close my eyes lightly whenever I feel lonely again
I no longer fear when your breath holds me
No one in the world can replace you
You are the only one in I’ll be there for you baby
You and I together, It’s just feels so right
Even though i bid you goodbye, to me this world is just you
You and I together, don’t ever let go my hands
even though i bid you goodbye, to me this world is just you
Just you and I
Forever and ever..
No matter what happens
Even when the sky is falling down
I’ll promise you
That I’ll never let you go
Oh~~~Oh~~Oh~~~oh~~Oh~~~oh~~Yeah~~~
You naega sseureojilddae
Jeoldae heundeullimeopsi
Ganghan nunbicheuro
Myeotbeonigo nal ileukyeojweo
And you, na himae gyeoulddae
Seulpeumeul byeolang kkeutkkaji ddo akkimeopsi
Chajawa du son japeun geudaeyegae
[Chorus]
Nan haejoongae eopneundae
Chorahan najiman
Oneul geudae wihae i norae booleoyo
Tonight geudaeye du noonae
Geu miso dwiae nalwihae gamchweowatdeon
Apeumiboyeoyo
You and I together
It just feels so right
Ibyuliran maleulhaedo
Geu nuga mweorahaedo nan geudael jikilgae
You and I together
Nae du soneul nochijima
Annyoungiran maleun haedo
Naegae i saesangeun ojik neo hanagiae
You maneun sarangcheoreom
Oori sarang yeokshi jogeumssik byunhagaetjyo
Hajiman jaebal seulpeo malayo
Oraen chinhan chingu cheoreom
Namaneul mideulsuitgae gidaelsuitgae
I promise you that I’ll be right here, baby
[Chorus]
Nan haejoongae eopneundae
Chorahan najiman
Oneul geudae wihae i norae booleoyo
Tonight geudaeye du noonae
Geu miso dwiae nalwihae gamchweowatdeon
Apeumiboyeoyo
You and I together
Nae du soneul nochijima
Annyoungiran maleun haedo
Naegae i saesangeun ojik neo hanagiae
Waeroun bami chajaolddaen
Na salmyeosi nooneul gamayo
Geudaeye soomgyeoli nal aneulddae
Mueotdo duryeopji anjyo
E saesang geu eoddeon nugudo
Geudaereul daeshin halsueopjyo
You are the only one
And I’ll be there for you, baby
You and I together
It just feels so right
Ibyeoliran maleulhaedo
Geu nuga mweorahaedo nan geudael jikilgae
You and I together
Nae du soneul nochijima
Annyoungiran maleunhaedo
Naegae i saesangeun ojik neo hanagiae
Just you and I
Forever and ever
****Translation****
No matter what happens
Even when the sky is falling down
I’ll promise you
That I’ll never let you go
Oh~~~Oh~~Oh~~~oh~~Oh~~~oh~~Yeah~~~
You, When I fell
you held me back up with an unfaltering gaze
And You, through those sad times
held my hands till the end of the world
[Chorus]
I might be a shabby person who has never done anything for you
But today, I am singing this song just for you
Tonight, within those two eyes and a smile
I can see the pains from protecting me
You and I together. It’s just feels so right
Even though i bid you goodbye, to me this world is just you
You and I together, don’t ever let go of my hands
even though i bid you goodbye, to me this world is just you
Our love has changed a bit by bit just like others
But don’t be sad
Hopefully I will be someone who you can trust like an old friend
and someone you can lean onto
I promise you that I’m be right here baby
[Chorus]
I might be a shabby person who has never done anything for you
But today, I am singing this song just for you
Tonight, within those two eyes
and smile I can see the pains from protecting me
You and I together. It’s just feels so right
Even though i bid you goodbye, to me this world is just you
You and I together, don’t ever let go of my hands
even though i bid you goodbye, to me this world is just you
I close my eyes lightly whenever I feel lonely again
I no longer fear when your breath holds me
No one in the world can replace you
You are the only one in I’ll be there for you baby
You and I together, It’s just feels so right
Even though i bid you goodbye, to me this world is just you
You and I together, don’t ever let go my hands
even though i bid you goodbye, to me this world is just you
Just you and I
Forever and ever..
Saturday, March 27, 2010
Every cloud has a silver lining
Every cloud has a silver lining means that you should never feel hopeless because difficult times always lead to better days. Example: "What am I going to do? My girlfriend has left me again!" Reply: "Don't worry. It will be all right. Every cloud has a silver lining."
http://www.goenglish.com/EveryCloudHasASilverLining.asp
http://www.goenglish.com/EveryCloudHasASilverLining.asp
Friday, March 26, 2010
Probability Uncertainty
decision theory - probability theory + utility theory (depends on my preference eg. represent how much time to spend waiting for flight)
- agent is rational when it chooses the action with the maximum expected utility taken over all results of actions
atomic event - a complete specification of the world about which the agent is uncertain, ie the rows of the truth table, setting all random variables
- mutually exclusive: at most one is true,
- exhaustive: at least one is true
disjunction rule?
P(a V b) = P(a) + P(b) - P(a ^ b)
Sum(P(A)) = 1
P(True) = 1
P(False) = 0
random values - assignment of values to random variables
unconditional probability P(A), prior, marginal, probability that A will appear in the absence of any other info
conditional probability P(effect|cause), posterior, new information (cause) can change probability of (effect)
eg P(a|b) = P(a ^ b) / P(b) , P(b) = denominator = normalization constant alpha
product rule: P(a ^ b) = P(a|b)P(b) = P(b|a)P(a)
also P(a^b^c) = P(a^b|c)P(c) = P(a|b^c)P(b^c)
independence:
if a and b are independent then P(a^b) = P(a)P(b)
P(a|b) = P(a)
objectivity - objectively observable, known
subjectivity - based on own degree of belief
eg. betting game
joint probability = table of all possible probability values
eg. P(pits in all spots, breeze in 3 places)
General idea: compute distribution on query variable by fixing evidence
variables and summing over hidden variables (H)
H = X - Y -E
eg. P(~cavity|toothache)
X = everything (toothache, cavity, catch)
Y = query (cavity)
E = evidence (toothache)
problems: exponential time and space complexities, how to fill in the numbers for all
conditionally independent:
A is conditionally independent of B given C:
P(A|B,C) = P(A|C) # throw B out from evidence
P(B|A,C) = P(B|C) # throw A out from evidence
P(A,B|C) = P(A|C) * P(B|C) # can't throw A and B because they are in the query
Baye's rule: for diagnosis, derived from product rule: P(a,b) = P(a|b)P(b) = P(b|a)P(a)
So P(a|b) = P(b|a)P(a)/P(b) = alpha * P(b|a)P(a)
P(cause|effect) = P(effect|cause)P(cause)/P(effect)
naive bayes - Baye's rule and conditional independence
P(Cause,Effect1, ... ,Effectn) = P(Cause) πiP(Effecti|Cause)
Probability is a rigorous formalism for uncertain knowledge
• Joint probability distribution specifies probability
of every atomic event
• Queries can be answered by summing over
atomic events
• For nontrivial domains, we must find a way to
reduce the joint size
• Independence and conditional independence
provide the tools
•
inference by enumeration using conditional independence
- agent is rational when it chooses the action with the maximum expected utility taken over all results of actions
atomic event - a complete specification of the world about which the agent is uncertain, ie the rows of the truth table, setting all random variables
- mutually exclusive: at most one is true,
- exhaustive: at least one is true
disjunction rule?
P(a V b) = P(a) + P(b) - P(a ^ b)
Sum(P(A)) = 1
P(True) = 1
P(False) = 0
random values - assignment of values to random variables
unconditional probability P(A), prior, marginal, probability that A will appear in the absence of any other info
conditional probability P(effect|cause), posterior, new information (cause) can change probability of (effect)
eg P(a|b) = P(a ^ b) / P(b) , P(b) = denominator = normalization constant alpha
product rule: P(a ^ b) = P(a|b)P(b) = P(b|a)P(a)
also P(a^b^c) = P(a^b|c)P(c) = P(a|b^c)P(b^c)
independence:
if a and b are independent then P(a^b) = P(a)P(b)
P(a|b) = P(a)
objectivity - objectively observable, known
subjectivity - based on own degree of belief
eg. betting game
joint probability = table of all possible probability values
eg. P(pits in all spots, breeze in 3 places)
General idea: compute distribution on query variable by fixing evidence
variables and summing over hidden variables (H)
H = X - Y -E
eg. P(~cavity|toothache)
X = everything (toothache, cavity, catch)
Y = query (cavity)
E = evidence (toothache)
problems: exponential time and space complexities, how to fill in the numbers for all
conditionally independent:
A is conditionally independent of B given C:
P(A|B,C) = P(A|C) # throw B out from evidence
P(B|A,C) = P(B|C) # throw A out from evidence
P(A,B|C) = P(A|C) * P(B|C) # can't throw A and B because they are in the query
Baye's rule: for diagnosis, derived from product rule: P(a,b) = P(a|b)P(b) = P(b|a)P(a)
So P(a|b) = P(b|a)P(a)/P(b) = alpha * P(b|a)P(a)
P(cause|effect) = P(effect|cause)P(cause)/P(effect)
naive bayes - Baye's rule and conditional independence
P(Cause,Effect1, ... ,Effectn) = P(Cause) πiP(Effecti|Cause)
Probability is a rigorous formalism for uncertain knowledge
• Joint probability distribution specifies probability
of every atomic event
• Queries can be answered by summing over
atomic events
• For nontrivial domains, we must find a way to
reduce the joint size
• Independence and conditional independence
provide the tools
•
inference by enumeration using conditional independence
Thursday, March 25, 2010
Plant genomics
Special Issue:
Arabidopsis: A rich harvest 10 years after completion
of the genome sequence.
The year 2010 marks the 10th anniversary of the publication of the fully assembled Arabidopsis nuclear genome DNA sequence and on this occasion, we at The Plant Journal wish to offer an opportunity to look back and highlight some of the numerous accomplishments in plant science, and beyond, that the availability of the first plant nuclear genome DNA sequence has spawned.
We would like to thank all of those who have contributed to achieving the highest possible scientific standard for the articles in this Special Issue and hope you, our Readers, enjoy it.
Peter McCourt and Christoph Benning
Click here to browse the table of contents or click on the links below to access the full paper directly:
Editorial
Arabidopsis: A rich harvest 10 years after completion of the genome sequence
Peter McCourt, Christoph Benning
Original Articles
The development of Arabidopsis as a model plant
Maarten Koornneef, David Meinke
Shotguns and SNPs: how fast and cheap sequencing is revolutionizing plant biology
Steven D. Rounsley, Robert L. Last
Linking genotype to phenotype using the Arabidopsis unimutant collection
Ronan C. O'Malley, Joseph R. Ecker
Small RNAs – secrets and surprises of the genome
Xuemei Chen
Embryogenesis – the humble beginnings of plant life
Ive De Smet, Steffen Lau, Ulrike Mayer, Gerd Jürgens
Arabidopsis seed secrets unravelled after a decade of genetic and omics-driven research
Helen North, Sébastien Baud, Isabelle Debeaujon, Christian Dubos, Bertrand Dubreucq, Philippe Grappin, Marc Jullien, Loïc Lepiniec, Annie Marion-Poll, Martine Miquel, Loïc Rajjou, Jean-Marc Routaboul, Michel Caboche
Light signal transduction: an infinite spectrum of possibilities
Joanne Chory
Getting to the root of plant biology: impact of the Arabidopsis genome sequence on root research
Philip N. Benfey, Malcolm Bennett, John Schiefelbein
Seasonal and developmental timing of flowering
Richard Amasino
The flowering of Arabidopsis flower development
Vivian F. Irish
The ubiquitin-proteasome system regulates plant hormone signaling
Aaron Santner, Mark Estelle
Research on plant abiotic stress responses in the post-genome era: past, present and future
Takashi Hirayama, Kazuo Shinozaki
Arabidopsis and the plant immune system
Marc T. Nishimura, Jeffery L. Dangl
Arabidopsis and primary photosynthetic metabolism – more than the icing on the cake
Mark Stitt, John Lunn, Björn Usadel
Lipid biochemists salute the genome
James G. Wallis, John Browse
Arabidopsis – a powerful model system for plant cell wall research
Aaron H. Liepman, Raymond Wightman, Naomi Geshi, Simon R. Turner, Henrik Vibe Scheller
Special Issue Podcast The Special Issue is also accompanied by a podcast – a conversation between Christoph Benning, Co-Editor of this Special Issue and Professor of Biochemistry and Molecular Biology at Michigan State University in East Lansing Michigan , Caroline Dean, Project Leader at the John Innes Centre in Norwich in England, Elliot Meyerowitz, George W. Beadle Professor of Biology at the California Institute of Technology in Pasadena, California, and Chris Somerville, Director of the Energy Biosciences Institute in Berkeley, California.
Arabidopsis: A rich harvest 10 years after completion
of the genome sequence.
The year 2010 marks the 10th anniversary of the publication of the fully assembled Arabidopsis nuclear genome DNA sequence and on this occasion, we at The Plant Journal wish to offer an opportunity to look back and highlight some of the numerous accomplishments in plant science, and beyond, that the availability of the first plant nuclear genome DNA sequence has spawned.
We would like to thank all of those who have contributed to achieving the highest possible scientific standard for the articles in this Special Issue and hope you, our Readers, enjoy it.
Peter McCourt and Christoph Benning
Click here to browse the table of contents or click on the links below to access the full paper directly:
Editorial
Arabidopsis: A rich harvest 10 years after completion of the genome sequence
Peter McCourt, Christoph Benning
Original Articles
The development of Arabidopsis as a model plant
Maarten Koornneef, David Meinke
Shotguns and SNPs: how fast and cheap sequencing is revolutionizing plant biology
Steven D. Rounsley, Robert L. Last
Linking genotype to phenotype using the Arabidopsis unimutant collection
Ronan C. O'Malley, Joseph R. Ecker
Small RNAs – secrets and surprises of the genome
Xuemei Chen
Embryogenesis – the humble beginnings of plant life
Ive De Smet, Steffen Lau, Ulrike Mayer, Gerd Jürgens
Arabidopsis seed secrets unravelled after a decade of genetic and omics-driven research
Helen North, Sébastien Baud, Isabelle Debeaujon, Christian Dubos, Bertrand Dubreucq, Philippe Grappin, Marc Jullien, Loïc Lepiniec, Annie Marion-Poll, Martine Miquel, Loïc Rajjou, Jean-Marc Routaboul, Michel Caboche
Light signal transduction: an infinite spectrum of possibilities
Joanne Chory
Getting to the root of plant biology: impact of the Arabidopsis genome sequence on root research
Philip N. Benfey, Malcolm Bennett, John Schiefelbein
Seasonal and developmental timing of flowering
Richard Amasino
The flowering of Arabidopsis flower development
Vivian F. Irish
The ubiquitin-proteasome system regulates plant hormone signaling
Aaron Santner, Mark Estelle
Research on plant abiotic stress responses in the post-genome era: past, present and future
Takashi Hirayama, Kazuo Shinozaki
Arabidopsis and the plant immune system
Marc T. Nishimura, Jeffery L. Dangl
Arabidopsis and primary photosynthetic metabolism – more than the icing on the cake
Mark Stitt, John Lunn, Björn Usadel
Lipid biochemists salute the genome
James G. Wallis, John Browse
Arabidopsis – a powerful model system for plant cell wall research
Aaron H. Liepman, Raymond Wightman, Naomi Geshi, Simon R. Turner, Henrik Vibe Scheller
Special Issue Podcast The Special Issue is also accompanied by a podcast – a conversation between Christoph Benning, Co-Editor of this Special Issue and Professor of Biochemistry and Molecular Biology at Michigan State University in East Lansing Michigan , Caroline Dean, Project Leader at the John Innes Centre in Norwich in England, Elliot Meyerowitz, George W. Beadle Professor of Biology at the California Institute of Technology in Pasadena, California, and Chris Somerville, Director of the Energy Biosciences Institute in Berkeley, California.
Wednesday, March 24, 2010
Orthogonal
Orthogonal:
- perpendicular, 90 degree angle, X
- It is also widely used to describe conditions that are contradictory, or opposite, rather than in parallel or in sync with each other.
- perpendicular, 90 degree angle, X
- It is also widely used to describe conditions that are contradictory, or opposite, rather than in parallel or in sync with each other.
Tuesday, March 23, 2010
Programming in R
http://manuals.bioinformatics.ucr.edu/home/programming-in-r
http://www.r-cookbook.com/node/2
http://cran.r-project.org/doc/manuals/R-intro.html
http://www.statmethods.net/interface/io.html
http://biocodenv.com/wordpress/?p=15 http://biocodenv.com/wordpress/?p=15
Sample script: refillsMisses.R
{{{
#!/usr/bin/Rscript
args <- c('1min_interval_data_clean.txt', '1min_interval_refillsMisses.txt', '1min_interval_refillsMisses.png', 'mcf')
#args <- c('z', '1min_interval_refillsMisses.txt', 'z.png', 'perl')
infile <- args[1]
outfile <- args[2]
outplot <- args[3]
filter <- args[4]
# read in data from infile
inFrame <- data.frame(read.table(infile, header=1))
inFrame <- subset(inFrame, PROG==filter)
# calculations between select columns
miss <- inFrame['DATA_CACHE_MISSES']
acc <- inFrame['DATA_CACHE_ACCESSES']
ret <- inFrame['RETIRED_INSTRUCTIONS']
ref <- inFrame["DATA_CACHE_REFILLS.ALL"]
prog <- inFrame['PROG']
refMiss <- data.frame(ref-miss)
colnames(refMiss) <- "RefillsMinusMiss"
missAcc <- data.frame(miss/acc*refMiss)
colnames(missAcc) <- 'MissDivAccessMultDiff'
# create output data frame with calculated columns
outFrame <- data.frame(inFrame, refMiss, missAcc)
# write to outfile
write.table(outFrame, file=outfile, row.names=FALSE, quote=FALSE)
# plot
png(outplot)
missAccMat <- as.matrix(missAcc)[,1]
missMat <- as.matrix(miss)[,1]
retMat <- as.matrix(ret)[,1]
#http://www.astrostatistics.psu.edu/su09/lecturenotes/clus2.html
#scatterplot3d(missAccMat, missMat, retMat)
plot(missAccMat, retMat, col='red', pch=15)
}}}
# open plotting window
op <- par(mfrow=c(2, 2))
# draw histogram
hist(x)
Filtering without subset, subset seems to modify the input matrix
Is this what you want?
> tt <- matrix(1:20, ncol = 4)
> tt
[,1] [,2] [,3] [,4]
[1,] 1 6 11 16
[2,] 2 7 12 17
[3,] 3 8 13 18
[4,] 4 9 14 19
[5,] 5 10 15 20
> tt[tt[,1] < 3, ]
[,1] [,2] [,3] [,4]
[1,] 1 6 11 16
[2,] 2 7 12 17
http://www.r-cookbook.com/node/2
http://cran.r-project.org/doc/manuals/R-intro.html
http://www.statmethods.net/interface/io.html
http://biocodenv.com/wordpress/?p=15 http://biocodenv.com/wordpress/?p=15
Sample script: refillsMisses.R
{{{
#!/usr/bin/Rscript
args <- c('1min_interval_data_clean.txt', '1min_interval_refillsMisses.txt', '1min_interval_refillsMisses.png', 'mcf')
#args <- c('z', '1min_interval_refillsMisses.txt', 'z.png', 'perl')
infile <- args[1]
outfile <- args[2]
outplot <- args[3]
filter <- args[4]
# read in data from infile
inFrame <- data.frame(read.table(infile, header=1))
inFrame <- subset(inFrame, PROG==filter)
# calculations between select columns
miss <- inFrame['DATA_CACHE_MISSES']
acc <- inFrame['DATA_CACHE_ACCESSES']
ret <- inFrame['RETIRED_INSTRUCTIONS']
ref <- inFrame["DATA_CACHE_REFILLS.ALL"]
prog <- inFrame['PROG']
refMiss <- data.frame(ref-miss)
colnames(refMiss) <- "RefillsMinusMiss"
missAcc <- data.frame(miss/acc*refMiss)
colnames(missAcc) <- 'MissDivAccessMultDiff'
# create output data frame with calculated columns
outFrame <- data.frame(inFrame, refMiss, missAcc)
# write to outfile
write.table(outFrame, file=outfile, row.names=FALSE, quote=FALSE)
# plot
png(outplot)
missAccMat <- as.matrix(missAcc)[,1]
missMat <- as.matrix(miss)[,1]
retMat <- as.matrix(ret)[,1]
#http://www.astrostatistics.psu.edu/su09/lecturenotes/clus2.html
#scatterplot3d(missAccMat, missMat, retMat)
plot(missAccMat, retMat, col='red', pch=15)
}}}
# open plotting window
op <- par(mfrow=c(2, 2))
# draw histogram
hist(x)
Filtering without subset, subset seems to modify the input matrix
Is this what you want?
> tt <- matrix(1:20, ncol = 4)
> tt
[,1] [,2] [,3] [,4]
[1,] 1 6 11 16
[2,] 2 7 12 17
[3,] 3 8 13 18
[4,] 4 9 14 19
[5,] 5 10 15 20
> tt[tt[,1] < 3, ]
[,1] [,2] [,3] [,4]
[1,] 1 6 11 16
[2,] 2 7 12 17
Monday, March 22, 2010
The Bets
http://www.docstoc.com/docs/26993860/Artificial-Reasoning 30/85 - The Bets
Bets on B (5/8) - you bet $5 and bookmarker bets $3
Bets on ~B (3/4) - you bet $6 and bookmarker bets $2
You suffer a net loss both ways. See Pay Off Matrix.
So it needs to be P(B) = P(~B)
or if a and b are mutually exclusive then P(avb) = P(a) + P(b)
so subjective bliefs (betting rates) should follow the basic rules of probability so that there's no sure-loss
http://en.wikipedia.org/wiki/Bayes%27_theorem
P(A|B) = \frac{P(B | A)\, P(A)}{P(B)}.
P(A|B) = (P(B|A)*P(A))/P(B)
Bets on B (5/8) - you bet $5 and bookmarker bets $3
Bets on ~B (3/4) - you bet $6 and bookmarker bets $2
You suffer a net loss both ways. See Pay Off Matrix.
So it needs to be P(B) = P(~B)
or if a and b are mutually exclusive then P(avb) = P(a) + P(b)
so subjective bliefs (betting rates) should follow the basic rules of probability so that there's no sure-loss
http://en.wikipedia.org/wiki/Bayes%27_theorem
P(A|B) = \frac{P(B | A)\, P(A)}{P(B)}.
P(A|B) = (P(B|A)*P(A))/P(B)
Sunday, March 21, 2010
Friday, March 19, 2010
E: Sub-process /usr/bin/dpkg returned an error code (1)
https://bugs.launchpad.net/ubuntu/+source/nvidia-common/+bug/331675
Workaround:
(cd /usr/bin/; sudo mv nvidia-detector nvidia-detector2)
Then finish installing nvidia-common
(cd /usr/bin/; sudo mv nvidia-detector2 nvidia-detector)
Should work. The problem looks like that it tries to execute the python script before the python libraries are installed!
Problem:
run-parts: executing /etc/kernel/header_postinst.d/nvidia-common
Traceback (most recent call last):
File "/usr/bin/nvidia-detector", line 2, in
import NvidiaDetector
ImportError: No module named NvidiaDetector
run-parts: /etc/kernel/header_postinst.d/nvidia-common exited with return code 1
Failed to process /etc/kernel/header_postinst.d at /var/lib/dpkg/info/linux-headers-2.6.28-8-generic.postinst line 110.
dpkg: error processing linux-headers-2.6.28-8-generic (--configure):
subprocess post-installation script returned error exit status 2
dpkg: dependency problems prevent configuration of linux-headers-generic:
linux-headers-generic depends on linux-headers-2.6.28-8-generic; however:
Package linux-headers-2.6.28-8-generic is not configured yet.
dpkg: error processing linux-headers-generic (--configure):
dependency problems - leaving unconfigured
were encountered while processing:
linux-image-2.6.28-8-generic
linux-restricted-modules-2.6.28-8-generic
linux-image-generic
linux-restricted-modules-generic
linux-generic
linux-image
linux-headers-2.6.28-8-generic
linux-headers-generic
E: Sub-process /usr/bin/dpkg returned an error code (1)
Workaround:
(cd /usr/bin/; sudo mv nvidia-detector nvidia-detector2)
Then finish installing nvidia-common
(cd /usr/bin/; sudo mv nvidia-detector2 nvidia-detector)
Should work. The problem looks like that it tries to execute the python script before the python libraries are installed!
Problem:
run-parts: executing /etc/kernel/header_postinst.d/nvidia-common
Traceback (most recent call last):
File "/usr/bin/nvidia-detector", line 2, in
import NvidiaDetector
ImportError: No module named NvidiaDetector
run-parts: /etc/kernel/header_postinst.d/nvidia-common exited with return code 1
Failed to process /etc/kernel/header_postinst.d at /var/lib/dpkg/info/linux-headers-2.6.28-8-generic.postinst line 110.
dpkg: error processing linux-headers-2.6.28-8-generic (--configure):
subprocess post-installation script returned error exit status 2
dpkg: dependency problems prevent configuration of linux-headers-generic:
linux-headers-generic depends on linux-headers-2.6.28-8-generic; however:
Package linux-headers-2.6.28-8-generic is not configured yet.
dpkg: error processing linux-headers-generic (--configure):
dependency problems - leaving unconfigured
were encountered while processing:
linux-image-2.6.28-8-generic
linux-restricted-modules-2.6.28-8-generic
linux-image-generic
linux-restricted-modules-generic
linux-generic
linux-image
linux-headers-2.6.28-8-generic
linux-headers-generic
E: Sub-process /usr/bin/dpkg returned an error code (1)
Workopolis - Top 10 interview mistakes
http://www.youtube.com/watch?v=U9rn5kuTpHw
* don't be late
* give a professional appearance
* proper body language
* give complete and concise answers
* turn off electronics
Keep in mind that you want to focus on what you can do for the company, not what they are going to do for you.
Networking tips
http://money.cnn.com/2010/03/19/news/economy/shyness_jobs_interviews.fortune/index.htm?source=cnn_bin&hpt=Sbin
* don't be late
* give a professional appearance
* proper body language
* give complete and concise answers
* turn off electronics
Keep in mind that you want to focus on what you can do for the company, not what they are going to do for you.
Networking tips
http://money.cnn.com/2010/03/19/news/economy/shyness_jobs_interviews.fortune/index.htm?source=cnn_bin&hpt=Sbin
Thursday, March 18, 2010
TLRs and innate immunity
http://en.wikipedia.org/wiki/Toll-like_receptor
Toll-like receptors (TLRs) are a class of proteins that play a key role in the innate immune system. They are single membrane-spanning non-catalytic receptors that recognize structurally conserved molecules derived from microbes. Once these microbes have breached physical barriers such as the skin or intestinal tract mucosa, they are recognized by TLRs which activates immune cell responses.
More than 100 years ago, Richard Pfeiffer, a student of Robert Koch, coined the term "endotoxin" to describe a substance produced by Gram-negative bacteria that could provoke fever and shock in experimental animals.
Toll-like receptors (TLRs) are a class of proteins that play a key role in the innate immune system. They are single membrane-spanning non-catalytic receptors that recognize structurally conserved molecules derived from microbes. Once these microbes have breached physical barriers such as the skin or intestinal tract mucosa, they are recognized by TLRs which activates immune cell responses.
More than 100 years ago, Richard Pfeiffer, a student of Robert Koch, coined the term "endotoxin" to describe a substance produced by Gram-negative bacteria that could provoke fever and shock in experimental animals.
Wednesday, March 17, 2010
Beautiful
Beautiful
zooey deschanel
Natalie Portman
Drama: Midas, Wonderful Radio (aka Love on Air) (OST Bitter) (2012)
Kwai Lun-mei (桂纶镁)
http://en.wikipedia.org/wiki/Kwai_Lun-mei

Lee Yeon-hee
http://en.wikipedia.org/wiki/Lee_Yeon_Hee

Son-Ye-Jin
http://en.wikipedia.org/wiki/Son_Ye-jin

Ryoko Hirosue - Summers Snow, Okuribito
http://www.ryoko-hirosue.org/
Alice Cullen (Ashley Greene) - Twilight - New Moon

Lee Ji Ah (The Legend, Beethoven Virus, The_Legend)
Téa Leoni

Stephanie Sun (singer)
why do nice guys finish last
http://www.themodernman.com/nice_guys.html
in short, forget about them -- sayonara
bonjour solitaire / solitary
-fin.
in short, forget about them -- sayonara
bonjour solitaire / solitary
-fin.
Sub-process /usr/bin/dpkg returned an error code
Error:
files list file for package `linux-image-2.6.24-19-generic' is missing final newline
Errors were encountered while processing:
/var/cache/apt/archives/linux-image-2.6.24-19-generic_2.6.24-19.36_i386.deb
Processing was halted because there were too many errors.
E: Sub-process /usr/bin/dpkg returned an error code (1)
Fix:
https://lists.ubuntu.com/archives/ubuntu-users/2007-January/104520.html
# move the info dir containing corrupted data out of the
# way, and create a new 'info' dir
cd /var/lib/dpkg
sudo mv info info.bak
sudo mkdir info
# reinstall the affected package, in my case this was
sudo apt-get --reinstall install libgtk1.2
# this will print lots of warnings about missing list
# files for the dependencies, which is obvious.
# now move the newly generated files in 'info/' to the
# 'info.bak/' directory containing info for all packages
# this will replace the information for the package
# we just installed
sudo mv info/* info.bak/
# and now get things back to where they were
sudo rm -rf info
files list file for package `linux-image-2.6.24-19-generic' is missing final newline
Errors were encountered while processing:
/var/cache/apt/archives/linux-image-2.6.24-19-generic_2.6.24-19.36_i386.deb
Processing was halted because there were too many errors.
E: Sub-process /usr/bin/dpkg returned an error code (1)
Fix:
https://lists.ubuntu.com/archives/ubuntu-users/2007-January/104520.html
# move the info dir containing corrupted data out of the
# way, and create a new 'info' dir
cd /var/lib/dpkg
sudo mv info info.bak
sudo mkdir info
# reinstall the affected package, in my case this was
sudo apt-get --reinstall install libgtk1.2
# this will print lots of warnings about missing list
# files for the dependencies, which is obvious.
# now move the newly generated files in 'info/' to the
# 'info.bak/' directory containing info for all packages
# this will replace the information for the package
# we just installed
sudo mv info/* info.bak/
# and now get things back to where they were
sudo rm -rf info
alien stone
i maybe a stone, tough on the inside and out and yet as time goes on, i too crumble a bit at a time, i am just a stone after all ...
feels like an alien too, like you don't belong in this world, probably cuz i've been immersed with too much fantasy, anime, dramas lol.
feels like an alien too, like you don't belong in this world, probably cuz i've been immersed with too much fantasy, anime, dramas lol.
pessimist and optimist
A pessimist sees the difficulty in every opportunity;
an optimist sees the opportunity in every difficulty.
—Sir Winston Churchill
an optimist sees the opportunity in every difficulty.
—Sir Winston Churchill
Tuesday, March 16, 2010
Light and Plant Development
1. (9 marks total) These questions pertain to phytochrome and plant development
(a) (2 marks) What is meant by the “photoreversibility” of phytochrome?
Phytochrome exists in 2 interconvertible forms: Pr and Pfr
Conversion of Pr (inactive form) to Pfr (active form) when red light is applied and the process is reversed when far red light is applied

(b) (3 marks) Indicate and explain 3 events involved in the signal transduction pathway leading to active Pfr upon red light illumination (eg. some of the structural and other changes to phytochrome)
Assembly of phytochrome which is a dimer composed of chromophore pigment + polypeptide
chromophore undergoes cis to trans isomerazation when red light is absorbed
Phy protein also undergoes photoreversible conformational change when light is absorbed, autophosphorylation at the Ser in hinge region to expose the PAS domain repeats that contains nuclear localization signals that directs the active form of Pfr into nucleus (regulates gene expression)
His-kinase-related domain mediates autophosphorylation
small amounts of phytochrome remains in the cytosol which mediates rapid responses
(c) (2 marks) What modifying enzymes subsequently affect the stability or activity of the physiologically active form (Pfr) and how do they act?
When Pfr is autophosphorylated at the Ser in the hinge region, it’s less active and less stable form, so phosphatase PAPP5 dephosphorylates the phytochrome making it fully active and stable
On the other hand, a kinase does the reverse process, it phosporylates Pfr to make Pfr less active and less stable so that it can be degraded by proteasome
(d) (2 marks) Once Pfr is activated indicate some processes at the cellular level that are triggered when Pfr remains in the cytosol (Hint: these are changes that mediate rapid responses, the answer is not changes in gene expression. You can indicate the types of responses that are triggered as part of your answer).
- when Pfr is activated, rapid responses (due to ion fluxes) at the cellular level are triggered which cause relatively rapid turgor changes (cell volume changes – swelling / shrinking), organelle movements, stem elongation in pigweeds and in sun plants as shade avoidance response
At equilibrium:
-Saturating red light
85% Pfr
15% Pr
-Saturating far red light
97% Pr
3% Pfr
functional domains of phytochrome:
1. N-terminal half
- Chromophore-binding bilin lyase domain
- PHY domain – stablizes phytochrome in Pfr form
2. Hinge region
- Separates N- from C-terminus; role in conversion: Pr Pfr (active form)
3. PAS domain repeats
- Mediates dimerization & interactions with downstream effector proteins
- Contains NLS (nuclear localization signals) – when exposed, NLSs direct
active form of phytochrome (Pfr) into nucleus
4. His-kinase-related domain
- Mediates autophosphorylation
- Important for stopping phytochrome responses
fluence = amount of light
Law of Reciprocity (VLFR - very low fluence response & LFR)
- Response can be induced by brief pulses of light, provided that the total
amount of light energy adds up to the required fluence
HIR - high irridiance (fluence rate) response
– Need long exposure to light of high irradiance
– Not photoreversible
– Reciprocity does not apply
• i.e. cannot provide dimmer light for a longer time
• Dependent on fluence rate NOT fluence
- eg. induction of flowering, production of ethylene, enlargement of cotyledons, inhibition of hypocotyl elongation
daylight = more red light
canopy and soil = more far-red light
sun plants exhibit shade avoidance in canopies (shade = far-red light only passes through, leaves filters out red-light) - Stem elongates to lift leaves towards light, so in shade, lots of Far-red light, so Pfr is converted to Pr so there's low Pfr:Ptotal ratio when stem elongates
shade-tolerant plants don't do shade avoidance
high Pfr:Ptotal (lots of light) promotes seed germination, optimal growth conditions
photomorphogenesis - driven by changes in gene expression (eg. MYB, LHCB), slower, long term process, convert etiolated (seedling grown in dark, soil - long hypocotyl, apical hook, no chlorophyll) to de-etiolated
in the dark, it's in inactive form, Pr
when red light is present, it is converted to Pfr
How phytochrome was discovered: seeds germinated when exposed to red-light and inhibited when exposed to far-red light (petri dish with seeds), R/FR/R = germinate, the last one determines
(a) (2 marks) What is meant by the “photoreversibility” of phytochrome?
Phytochrome exists in 2 interconvertible forms: Pr and Pfr
Conversion of Pr (inactive form) to Pfr (active form) when red light is applied and the process is reversed when far red light is applied

(b) (3 marks) Indicate and explain 3 events involved in the signal transduction pathway leading to active Pfr upon red light illumination (eg. some of the structural and other changes to phytochrome)
Assembly of phytochrome which is a dimer composed of chromophore pigment + polypeptide
chromophore undergoes cis to trans isomerazation when red light is absorbed
Phy protein also undergoes photoreversible conformational change when light is absorbed, autophosphorylation at the Ser in hinge region to expose the PAS domain repeats that contains nuclear localization signals that directs the active form of Pfr into nucleus (regulates gene expression)
His-kinase-related domain mediates autophosphorylation
small amounts of phytochrome remains in the cytosol which mediates rapid responses
(c) (2 marks) What modifying enzymes subsequently affect the stability or activity of the physiologically active form (Pfr) and how do they act?
When Pfr is autophosphorylated at the Ser in the hinge region, it’s less active and less stable form, so phosphatase PAPP5 dephosphorylates the phytochrome making it fully active and stable
On the other hand, a kinase does the reverse process, it phosporylates Pfr to make Pfr less active and less stable so that it can be degraded by proteasome
(d) (2 marks) Once Pfr is activated indicate some processes at the cellular level that are triggered when Pfr remains in the cytosol (Hint: these are changes that mediate rapid responses, the answer is not changes in gene expression. You can indicate the types of responses that are triggered as part of your answer).
- when Pfr is activated, rapid responses (due to ion fluxes) at the cellular level are triggered which cause relatively rapid turgor changes (cell volume changes – swelling / shrinking), organelle movements, stem elongation in pigweeds and in sun plants as shade avoidance response
At equilibrium:
-Saturating red light
85% Pfr
15% Pr
-Saturating far red light
97% Pr
3% Pfr
functional domains of phytochrome:
1. N-terminal half
- Chromophore-binding bilin lyase domain
- PHY domain – stablizes phytochrome in Pfr form
2. Hinge region
- Separates N- from C-terminus; role in conversion: Pr Pfr (active form)
3. PAS domain repeats
- Mediates dimerization & interactions with downstream effector proteins
- Contains NLS (nuclear localization signals) – when exposed, NLSs direct
active form of phytochrome (Pfr) into nucleus
4. His-kinase-related domain
- Mediates autophosphorylation
- Important for stopping phytochrome responses
fluence = amount of light
Law of Reciprocity (VLFR - very low fluence response & LFR)
- Response can be induced by brief pulses of light, provided that the total
amount of light energy adds up to the required fluence
HIR - high irridiance (fluence rate) response
– Need long exposure to light of high irradiance
– Not photoreversible
– Reciprocity does not apply
• i.e. cannot provide dimmer light for a longer time
• Dependent on fluence rate NOT fluence
- eg. induction of flowering, production of ethylene, enlargement of cotyledons, inhibition of hypocotyl elongation
daylight = more red light
canopy and soil = more far-red light
sun plants exhibit shade avoidance in canopies (shade = far-red light only passes through, leaves filters out red-light) - Stem elongates to lift leaves towards light, so in shade, lots of Far-red light, so Pfr is converted to Pr so there's low Pfr:Ptotal ratio when stem elongates
shade-tolerant plants don't do shade avoidance
high Pfr:Ptotal (lots of light) promotes seed germination, optimal growth conditions
photomorphogenesis - driven by changes in gene expression (eg. MYB, LHCB), slower, long term process, convert etiolated (seedling grown in dark, soil - long hypocotyl, apical hook, no chlorophyll) to de-etiolated
in the dark, it's in inactive form, Pr
when red light is present, it is converted to Pfr
How phytochrome was discovered: seeds germinated when exposed to red-light and inhibited when exposed to far-red light (petri dish with seeds), R/FR/R = germinate, the last one determines
Galaxy
Galaxy
http://galaxy.psu.edu/
Galaxy allows you to do analyses you cannot do anywhere else without the need to install or download anything. You can analyze multiple alignemnts, compare genomic annotations, profile metagenomic samples and much much more...
$ hg clone http://bitbucket.org/galaxy/galaxy-dist/
Fix this error by using virtualenv
> "/var/lib/python-support/python2.5/sqlalchemy/databases/sqlite.py",
> line 343, in reflecttable
> >> raise
> exceptions.NoSuchTableError(table.name)
> >> NoSuchTableError: migrate_version
http://pypi.python.org/pypi/virtualenv
$ virtualenv --not-site-packages ENV
$ export PATH=$HOME/ENV/bin:$PATH
$ ./run.sh
point your browser to
http://127.0.0.1:8080
http://localhost:8080/
http://galaxy.psu.edu/
Galaxy allows you to do analyses you cannot do anywhere else without the need to install or download anything. You can analyze multiple alignemnts, compare genomic annotations, profile metagenomic samples and much much more...
$ hg clone http://bitbucket.org/galaxy/galaxy-dist/
Fix this error by using virtualenv
> "/var/lib/python-support/python2.5/sqlalchemy/databases/sqlite.py",
> line 343, in reflecttable
> >> raise
> exceptions.NoSuchTableError(table.name)
> >> NoSuchTableError: migrate_version
http://pypi.python.org/pypi/virtualenv
$ virtualenv --not-site-packages ENV
$ export PATH=$HOME/ENV/bin:$PATH
$ ./run.sh
point your browser to
http://127.0.0.1:8080
http://localhost:8080/
BIRCH and bioLegato
BIRCH is a resource for molecular biology, consisting of software and databases
Most of the programs and databases of BIRCH have been unified through bioLegato. bioLegato is best thought of as a program that runs other programs. As new programs are added to BIRCH, they appear as menu items in bioLegato. bioLegato takes care of all the "behind the scenes" tasks, such as interconverting file formats, allowing the user to concentrate on the science.
http://home.cc.umanitoba.ca/~psgendb/quickintro/quickintro.html
Most of the programs and databases of BIRCH have been unified through bioLegato. bioLegato is best thought of as a program that runs other programs. As new programs are added to BIRCH, they appear as menu items in bioLegato. bioLegato takes care of all the "behind the scenes" tasks, such as interconverting file formats, allowing the user to concentrate on the science.
http://home.cc.umanitoba.ca/~psgendb/quickintro/quickintro.html
Monday, March 15, 2010
Criminology
http://www.prenhall.com/saferstein/
Criminalistics: An Introduction to Forensic Science, 9/e
Richard Saferstein
Glossary
Algor mortis Postmortem changes that cause a body to lose heat.
Autopsy The medical dissection and examination of a body in order to determine the cause of death.
Expert Witness An individual whom the court determines to possess knowledge relevant to the trial that is not expected of the average layperson.
Livor Mortis The medical condition that occurs after death and results in the settling of blood in areas of the body closest to the ground.
Locard’s Exchange Principle Whenever two objects come into contact with one another, there is exchange of materials between them.
Rigor Mortis The medical condition that occurs after death and results in the stiffening of muscle mass. The rigidity of the body gradually disappears 24 hours after death.
Criminalistics: An Introduction to Forensic Science, 9/e
Richard Saferstein
Glossary
Algor mortis Postmortem changes that cause a body to lose heat.
Autopsy The medical dissection and examination of a body in order to determine the cause of death.
Expert Witness An individual whom the court determines to possess knowledge relevant to the trial that is not expected of the average layperson.
Livor Mortis The medical condition that occurs after death and results in the settling of blood in areas of the body closest to the ground.
Locard’s Exchange Principle Whenever two objects come into contact with one another, there is exchange of materials between them.
Rigor Mortis The medical condition that occurs after death and results in the stiffening of muscle mass. The rigidity of the body gradually disappears 24 hours after death.
Python WSGI web test
Web Test
http://pythonpaste.org/webtest/
Werkzeug
http://werkzeug.pocoo.org/documentation/0.6/test.html
http://pythonpaste.org/webtest/
Werkzeug
http://werkzeug.pocoo.org/documentation/0.6/test.html
Friday, March 12, 2010
LIMS - laboratory information management system
http://en.wikipedia.org/wiki/Laboratory_information_management_system
description logics - dl, alc
Description logics
• Formalisms for expressing concepts, their attributes (or
associated roles), and the relationships between them.
• Can be regarded as providing a KR system based on a
structured representation of knowledge.
Description Logic: (p138) - Ch 9
Three types of non-logical symbols:
• atomic concepts:
Dog, Teenager, GraduateStudent
We include a distinguished concept: Thing
• roles: (all are atomic)
:Age, :Parent, :AreaOfStudy
• constants:
johnSmith, chair128
Four types of logical symbols:
• punctuation: [, ], (, )
• positive integers: 1, 2, 3, ...
• concept-forming operators: ALL, EXISTS, FILLS, AND
• connectives: =, =, and →
[AND Company
For example: [EXISTS 7 :Director]
[ALL :Manager [AND Woman
“a company with at least 7 directors,
whose managers are all women with [FILLS :Degree phD]]]
PhDs, and whose min salary is $24/hr” [FILLS :MinSalary $24.00/hour]]
([AND Surgeon Female] = Doctor) is not valid.
C= is subsumed-by
But it is entailed by a KB that contains
(Surgeon = [AND Specialist [FILLS :Specialty surgery]])
(Specialist C= Doctor)
computing subsumption, that is, determining
whether or not KB = (d subsumed-by e) - 'no negation of alpha query)
assumptions:
- KB is acyclic
- d is atomic, only appears once in LHS
- replace
Under these assumptions, it is sufficient to do the following:
• normalization: using the definitions in the KB, put d and e into a special
normal form, d′ and e′
• structure matching: determine if each part of e′ is matched by a part of d′.
- In other words, for every part of the more general concept,
there must be a corresponding part in the more specific one.
p153. [and person [fills :age 27]
computing satisfaction: To determine if KB = (c → e), we use the following procedure:
1. find the most specific concept d such that KB = (c → d)
2. determine whether or not KB = (d C= e), as before.
joe->person , canCorp, joe is manager of cancorp, manager of cancorp is canadian, so you get joe->canadian
computing classification:
- Positioning a new atom in a taxonomy is called classification
- wine example, Wine is at the top root node, then there's white-very-dry-bordeaux-wine
The Logic ALC
Main components:
• Concepts: classes of individuals
• Roles: binary relations between individuals
• Complex concepts using constructors
• Define terminology: TBox
• Give assertions: ABox
Examples:
• Concept names: Person, Female
• Role names: ParentOf, HasHusband
• Individual names: John, Mary
Assertion C(a) (in B&L it's a->C)
MotherWithoutDaughter = Mother ∀ParentOf.¬Female
(P erson M ale)(John)
A Tableaux Algorithm for ALC (Attributive Concept Language with Complements, more expressive DLs)
• Try to prove concept satisfiability by constructing a model.
• A tableau is a graph representing such a model.
• A set of tableaux expansion rules is used to construct the tableau.
• Either a model is constructed or there is an obvious contradiction.
• If tree T contains a clash the concept C is unsatisfiable.
Unfolded: expand every concept name occurring in C
• Formalisms for expressing concepts, their attributes (or
associated roles), and the relationships between them.
• Can be regarded as providing a KR system based on a
structured representation of knowledge.
Description Logic: (p138) - Ch 9
Three types of non-logical symbols:
• atomic concepts:
Dog, Teenager, GraduateStudent
We include a distinguished concept: Thing
• roles: (all are atomic)
:Age, :Parent, :AreaOfStudy
• constants:
johnSmith, chair128
Four types of logical symbols:
• punctuation: [, ], (, )
• positive integers: 1, 2, 3, ...
• concept-forming operators: ALL, EXISTS, FILLS, AND
• connectives: =, =, and →
[AND Company
For example: [EXISTS 7 :Director]
[ALL :Manager [AND Woman
“a company with at least 7 directors,
whose managers are all women with [FILLS :Degree phD]]]
PhDs, and whose min salary is $24/hr” [FILLS :MinSalary $24.00/hour]]
([AND Surgeon Female] = Doctor) is not valid.
C= is subsumed-by
But it is entailed by a KB that contains
(Surgeon = [AND Specialist [FILLS :Specialty surgery]])
(Specialist C= Doctor)
computing subsumption, that is, determining
whether or not KB = (d subsumed-by e) - 'no negation of alpha query)
assumptions:
- KB is acyclic
- d is atomic, only appears once in LHS
- replace
Under these assumptions, it is sufficient to do the following:
• normalization: using the definitions in the KB, put d and e into a special
normal form, d′ and e′
• structure matching: determine if each part of e′ is matched by a part of d′.
- In other words, for every part of the more general concept,
there must be a corresponding part in the more specific one.
p153. [and person [fills :age 27]
computing satisfaction: To determine if KB = (c → e), we use the following procedure:
1. find the most specific concept d such that KB = (c → d)
2. determine whether or not KB = (d C= e), as before.
joe->person , canCorp, joe is manager of cancorp, manager of cancorp is canadian, so you get joe->canadian
computing classification:
- Positioning a new atom in a taxonomy is called classification
- wine example, Wine is at the top root node, then there's white-very-dry-bordeaux-wine
The Logic ALC
Main components:
• Concepts: classes of individuals
• Roles: binary relations between individuals
• Complex concepts using constructors
• Define terminology: TBox
• Give assertions: ABox
Examples:
• Concept names: Person, Female
• Role names: ParentOf, HasHusband
• Individual names: John, Mary
Assertion C(a) (in B&L it's a->C)
MotherWithoutDaughter = Mother ∀ParentOf.¬Female
(P erson M ale)(John)
A Tableaux Algorithm for ALC (Attributive Concept Language with Complements, more expressive DLs)
• Try to prove concept satisfiability by constructing a model.
• A tableau is a graph representing such a model.
• A set of tableaux expansion rules is used to construct the tableau.
• Either a model is constructed or there is an obvious contradiction.
• If tree T contains a clash the concept C is unsatisfiable.
Unfolded: expand every concept name occurring in C
Thursday, March 11, 2010
Open Data
http://radar.oreilly.com/2010/03/truly-open-data.html
open source practices to making data available to the public
http://agbt.org/about.html
The 11th annual Advances in Genome Biology and Technology (AGBT) meeting will be held in Marco Island, Florida, from February 24-27, 2010. The AGBT meeting is now widely regarded as the premier scientific forum for capturing information about the latest advances in new DNA sequencing technologies and their applications to diverse areas in biology and biomedical research. The meeting will have daytime plenary sessions that feature keynote speakers, additional invited speakers, and abstract-selected talks.
http://twitter.com/bffo
open source practices to making data available to the public
http://agbt.org/about.html
The 11th annual Advances in Genome Biology and Technology (AGBT) meeting will be held in Marco Island, Florida, from February 24-27, 2010. The AGBT meeting is now widely regarded as the premier scientific forum for capturing information about the latest advances in new DNA sequencing technologies and their applications to diverse areas in biology and biomedical research. The meeting will have daytime plenary sessions that feature keynote speakers, additional invited speakers, and abstract-selected talks.
http://twitter.com/bffo
Hematology and Oncology
http://answers.google.com/answers/threadview?id=509511
Hematology-Oncology(Heme/Onc) usually refers to the department
that sees patients with blood and platelet disorders and cancers that
are treated with a non-surgical therapy, such as bone marrow
transplant, stem cell transplant, pheresis, or chemotherapy. (Think
?liquid? therapy when differentiating heme/onc from oncology) Types of
cancer typically seen in a heme/onc department would be leukemias,
lymphomas, Hodgkins, non-Hodgkins, multiple myelomas and immunological
disorders. So, an oncologist is not a hematologist, or vice versa. But
a hematologist oncologist is a hematologist that specializes in the
diseases mentioned above. A hematologist oncologist would not treat
operable cancers such as prostate cancer.
Oncology usually refers a department that sees cancers that require
surgical treatment such as ovarian cancers, throat and digestive
system cancers, thyroid cancer, etc. Patients would be seen by an
oncologist or a surgeon with experience in cancer surgery. Some
doctors have received special training, or have experience with a
certain kind of medicine, and may see and treat patients themselves
without referring them to a specialist.
Because disorders and diseases seen in heme/onc often overlap, it is
more effective to have hematologists working closely with oncologists.
Many patients see both ?heme? and ?onc? doctors during the course of
their therapy. A breast cancer patient, for example, may be treated
with a bone marrow transplant or stem cell transplant, and her
oncologist would work in conjunction with the hematologist. Another
benefit to doctors and patients is the heme/onc clinic is equipped
with special microscopes and often have their own lab, which enables
the doctors and medical technologists to make rapid diagnosis, or
monitor patients quickly and efficiently. Hematologists and
oncologists are well trained specialists that have the skills to
identify cells under the microscope that general practice doctors
often don?t posses.
Hematology-Oncology(Heme/Onc) usually refers to the department
that sees patients with blood and platelet disorders and cancers that
are treated with a non-surgical therapy, such as bone marrow
transplant, stem cell transplant, pheresis, or chemotherapy. (Think
?liquid? therapy when differentiating heme/onc from oncology) Types of
cancer typically seen in a heme/onc department would be leukemias,
lymphomas, Hodgkins, non-Hodgkins, multiple myelomas and immunological
disorders. So, an oncologist is not a hematologist, or vice versa. But
a hematologist oncologist is a hematologist that specializes in the
diseases mentioned above. A hematologist oncologist would not treat
operable cancers such as prostate cancer.
Oncology usually refers a department that sees cancers that require
surgical treatment such as ovarian cancers, throat and digestive
system cancers, thyroid cancer, etc. Patients would be seen by an
oncologist or a surgeon with experience in cancer surgery. Some
doctors have received special training, or have experience with a
certain kind of medicine, and may see and treat patients themselves
without referring them to a specialist.
Because disorders and diseases seen in heme/onc often overlap, it is
more effective to have hematologists working closely with oncologists.
Many patients see both ?heme? and ?onc? doctors during the course of
their therapy. A breast cancer patient, for example, may be treated
with a bone marrow transplant or stem cell transplant, and her
oncologist would work in conjunction with the hematologist. Another
benefit to doctors and patients is the heme/onc clinic is equipped
with special microscopes and often have their own lab, which enables
the doctors and medical technologists to make rapid diagnosis, or
monitor patients quickly and efficiently. Hematologists and
oncologists are well trained specialists that have the skills to
identify cells under the microscope that general practice doctors
often don?t posses.
Wednesday, March 10, 2010
Hallmarks of Cancer
http://teachercenter.insidecancer.org/browse/Hallmarks%20of%20Cancer/
Hallmarks of Cancer
o Image:Hallmarks, Overview
Hallmarks, Overview
Cancer is a disease that affects people of all nationalities and age groups and all cancers start with mutations in one cell.
o Image:Hallmarks, Growing uncontrollably
Hallmarks, Growing uncontrollably
Professor Robert Weinberg explains that cancer cells have to learn how to grow in the absence of growth stimulatory signals that normal cells require from their environment.
o Image:Hallmarks, Evading death
Hallmarks, Evading death
Professor Robert Weinberg discusses how cancer cells have to learn how to avoid the process of programmed cell death known as apoptosis carried out in normal cells.
o Image:Hallmarks, Processing nutrients
Hallmarks, Processing nutrients
Professor Robert Weinberg explains how cancer cells have to learn how to become angiogenic, that is to say attract blood vessels to grow into the tumor mass.
o Image:Hallmarks, Becoming immortal
Hallmarks, Becoming immortal
Professor Robert Weinberg explains how normal cells can only double a certain limited number of times; and cancer cells have to learn how to proliferate indefinitely, i.e, they have to become immortalized.
o Image:Hallmarks, Invading tissues
Hallmarks, Invading tissues
Professor Robert Weinberg, explains that cancer cells have to learn how to invade and metastasize.
o Image:Hallmarks, Avoiding detection
Hallmarks, Avoiding detection
Bruce Stillman, Ph.D. is president and chief executive officer of Cold Spring Harbor Laboratory, explains that there are two adaptive immune responses, and those immune responses adapt to changes in cells in our body whether they be by infection or other.
o Image:Hallmarks, Promoting mutations
Hallmarks, Promoting mutations
Bruce Stillman, Ph.D., president of Cold Spring Harbor Laboratory, explains that genomic instability is a characteristic of cancer cells.
Hallmarks of Cancer
o Image:Hallmarks, Overview
Hallmarks, Overview
Cancer is a disease that affects people of all nationalities and age groups and all cancers start with mutations in one cell.
o Image:Hallmarks, Growing uncontrollably
Hallmarks, Growing uncontrollably
Professor Robert Weinberg explains that cancer cells have to learn how to grow in the absence of growth stimulatory signals that normal cells require from their environment.
o Image:Hallmarks, Evading death
Hallmarks, Evading death
Professor Robert Weinberg discusses how cancer cells have to learn how to avoid the process of programmed cell death known as apoptosis carried out in normal cells.
o Image:Hallmarks, Processing nutrients
Hallmarks, Processing nutrients
Professor Robert Weinberg explains how cancer cells have to learn how to become angiogenic, that is to say attract blood vessels to grow into the tumor mass.
o Image:Hallmarks, Becoming immortal
Hallmarks, Becoming immortal
Professor Robert Weinberg explains how normal cells can only double a certain limited number of times; and cancer cells have to learn how to proliferate indefinitely, i.e, they have to become immortalized.
o Image:Hallmarks, Invading tissues
Hallmarks, Invading tissues
Professor Robert Weinberg, explains that cancer cells have to learn how to invade and metastasize.
o Image:Hallmarks, Avoiding detection
Hallmarks, Avoiding detection
Bruce Stillman, Ph.D. is president and chief executive officer of Cold Spring Harbor Laboratory, explains that there are two adaptive immune responses, and those immune responses adapt to changes in cells in our body whether they be by infection or other.
o Image:Hallmarks, Promoting mutations
Hallmarks, Promoting mutations
Bruce Stillman, Ph.D., president of Cold Spring Harbor Laboratory, explains that genomic instability is a characteristic of cancer cells.
P-glycoprotein
http://www.rcsb.org/pdb/static.do?p=education_discussion/molecule_of_the_month/current_month.html
they pump toxins away from the cell, including cancer drugs, so they make them less useful, and this so cancers produce more P-glycoproteins to do just this.
so we are now trying to find ways to block P-glycoprotein from ejecting the drugs from the cells.
they pump toxins away from the cell, including cancer drugs, so they make them less useful, and this so cancers produce more P-glycoproteins to do just this.
so we are now trying to find ways to block P-glycoprotein from ejecting the drugs from the cells.
Ouellette and Stein -- Changing of the guard
http://www.nature.com/nature/journal/v428/n6982/full/nj6982-584a.html
Blast in ubuntu
BLAST
http://www.ncbi.nlm.nih.gov/staff/tao/URLAPI/unix_setup.html
http://www.ncbi.nlm.nih.gov/staff/tao/URLAPI/blastdb.html
Fasta -> DB
For nucleotide: formatdb -i input_db -p F -o T
For protein: formatdb -i input_db -p T -o T
----refp_db----
>gi|113722133|ref|NP_055861.3| probable helicase senataxin [Homo sapiens]
MSTCCWCTPGGASTIDFLKRYASNTPSGEFQTADEDLCYCLECVAEYHKARDELPFLHEVLWELETLRLI
NHFEKSMKAEIGDDDELYIVDNNGEMPLFDITGQDFENKLRVPLLEILKYPYLLLHERVNELCVEALCRM
EQANCSFQVFDKHPGIYLFLVHPNEMVRRWAILTARNLGKVDRDDYYDLQEVLLCLFKVIELGLLESPDI
YTSSVLEKGKLILLPSHMYDTTNYKSYWLGICMLLTILEEQAMDSLLLGSDKQNDFMQSILHTMEREADD
DSVDPFWPALHCFMVILDRLGSKVWGQLMDPIVAFQTIINNASYNREIRHIRNSSVRTKLEPESYLDDMV
TCSQIVYNYNPEKTKKDSGWRTAICPDYCPNMYEEMETLASVLQSDIGQDMRVHNSTFLWFIPFVQSLMD
LKDLGVAYIAQVVNHLYSEVKEVLNQTDAVCDKVTEFFLLILVSVIELHRNKKCLHLLWVSSQQWVEAVV
KCAKLPTTAFTRSSEKSSGNCSKGTAMISSLSLHSMPSNSVQLAYVQLIRSLLKEGYQLGQQSLCKRFWD
KLNLFLRGNLSLGWQLTSQETHELQSCLKQIIRNIKFKAPPCNTFVDLTSACKISPASYNKEESEQMGKT
SRKDMHCLEASSPTFSKEPMKVQDSVLIKADNTIEGDNNEQNYIKDVKLEDHLLAGSCLKQSSKNIFTER
AEDQIKISTRKQKSVKEISSYTPKDCTSRNGPERGCDRGIIVSTRLLTDSSTDALEKVSTSNEDFSLKDD
ALAKTSKRKTKVQKDEICAKLSHVIKKQHRKSTLVDNTINLDENLTVSNIESFYSRKDTGVQKGDGFIHN
LSLDPSGVLDDKNGEQKSQNNVLPKEKQLKNEELVIFSFHENNCKIQEFHVDGKELIPFTEMTNASEKKS
SPFKDLMTVPESRDEEMSNSTSVIYSNLTREQAPDISPKSDTLTDSQIDRDLHKLSLLAQASVITFPSDS
PQNSSQLQRKVKEDKRCFTANQNNVGDTSRGQVIIISDSDDDDDERILSLEKLTKQDKICLEREHPEQHV
STVNSKEEKNPVKEEKTETLFQFEESDSQCFEFESSSEVFSVWQDHPDDNNSVQDGEKKCLAPIANTTNG
QGCTDYVSEVVKKGAEGIEEHTRPRSISVEEFCEIEVKKPKRKRSEKPMAEDPVRPSSSVRNEGQSDTNK
RDLVGNDFKSIDRRTSTPNSRIQRATTVSQKKSSKLCTCTEPIRKVPVSKTPKKTHSDAKKGQNRSSNYL
SCRTTPAIVPPKKFRQCPEPTSTAEKLGLKKGPRKAYELSQRSLDYVAQLRDHGKTVGVVDTRKKTKLIS
PQNLSVRNNKKLLTSQELQMQRQIRPKSQKNRRRLSDCESTDVKRAGSHTAQNSDIFVPESDRSDYNCTG
GTEVLANSNRKQLIKCMPSEPETIKAKHGSPATDDACPLNQCDSVVLNGTVPTNEVIVSTSEDPLGGGDP
TARHIEMAALKEGEPDSSSDAEEDNLFLTQNDPEDMDLCSQMENDNYKLIELIHGKDTVEVEEDSVSRPQ
LESLSGTKCKYKDCLETTKNQGEYCPKHSEVKAADEDVFRKPGLPPPASKPLRPTTKIFSSKSTSRIAGL
SKSLETSSALSPSLKNKSKGIQSILKVPQPVPLIAQKPVGEMKNSCNVLHPQSPNNSNRQGCKVPFGESK
YFPSSSPVNILLSSQSVSDTFVKEVLKWKYEMFLNFGQCGPPASLCQSISRPVPVRFHNYGDYFNVFFPL
MVLNTFETVAQEWLNSPNRENFYQLQVRKFPADYIKYWEFAVYLEECELAKQLYPKENDLVFLAPERINE
EKKDTERNDIQDLHEYHSGYVHKFRRTSVMRNGKTECYLSIQTQENFPANLNELVNCIVISSLVTTQRKL
KAMSLLGSRNQLARAVLNPNPMDFCTKDLLTTTSERIIAYLRDFNEDQKKAIETAYAMVKHSPSVAKICL
IHGPPGTGKSKTIVGLLYRLLTENQRKGHSDENSNAKIKQNRVLVCAPSNAAVDELMKKIILEFKEKCKD
KKNPLGNCGDINLVRLGPEKSINSEVLKFSLDSQVNHRMKKELPSHVQAMHKRKEFLDYQLDELSRQRAL
CRGGREIQRQELDENISKVSKERQELASKIKEVQGRPQKTQSIIILESHIICCTLSTSGGLLLESAFRGQ
GGVPFSCVIVDEAGQSCEIETLTPLIHRCNKLILVGDPKQLPPTVISMKAQEYGYDQSMMARFCRLLEEN
VEHNMISRLPILQLTVQYRMHPDICLFPSNYVYNRNLKTNRQTEAIRCSSDWPFQPYLVFDVGDGSERRD
NDSYINVQEIKLVMEIIKLIKDKRKDVSFRNIGIITHYKAQKTMIQKDLDKEFDRKGPAEVDTVDAFQGR
QKDCVIVTCVRANSIQGSIGFLASLQRLNVTITRAKYSLFILGHLRTLMENQHWNQLIQDAQKRGAIIKT
CDKNYRHDAVKILKLKPVLQRSLTHPPTIAPEGSRPQGGLPSSKLDSGFAKTSVAASLYHTPSDSKEITL
TVTSKDPERPPVHDQLQDPRLLKRMGIEVKGGIFLWDPQPSSPQHPGATPPTGEPGFPVVHQDLSHIQQP
AAVVAALSSHKPPVRGEPPAASPEASTCQSKCDDPEEELCHRREARAFSEGEQEKCGSETHHTRRNSRWD
KRTLEQEDSSSKKRKLL
>gi|187233964|gb|ACD01221.1| TP53 [Homo sapiens]
RAMAIYKQSQHMTEVVRRCPTNERCSDSDGLAPPQHLIR
>gi|119395734|ref|NP_000050.2| breast cancer type 2 susceptibility protein [Homo sapiens]
MPIGSKERPTFFEIFKTRCNKADLGPISLNWFEELSSEAPPYNSEPAEESEHKNNNYEPNLFKTPQRKPS
YNQLASTPIIFKEQGLTLPLYQSPVKELDKFKLDLGRNVPNSRHKSLRTVKTKMDQADDVSCPLLNSCLS
ESPVVLQCTHVTPQRDKSVVCGSLFHTPKFVKGRQTPKHISESLGAEVDPDMSWSSSLATPPTLSSTVLI
VRNEEASETVFPHDTTANVKSYFSNHDESLKKNDRFIASVTDSENTNQREAASHGFGKTSGNSFKVNSCK
DHIGKSMPNVLEDEVYETVVDTSEEDSFSLCFSKCRTKNLQKVRTSKTRKKIFHEANADECEKSKNQVKE
KYSFVSEVEPNDTDPLDSNVANQKPFESGSDKISKEVVPSLACEWSQLTLSGLNGAQMEKIPLLHISSCD
QNISEKDLLDTENKRKKDFLTSENSLPRISSLPKSEKPLNEETVVNKRDEEQHLESHTDCILAVKQAISG
TSPVASSFQGIKKSIFRIRESPKETFNASFSGHMTDPNFKKETEASESGLEIHTVCSQKEDSLCPNLIDN
GSWPATTTQNSVALKNAGLISTLKKKTNKFIYAIHDETSYKGKKIPKDQKSELINCSAQFEANAFEAPLT
FANADSGLLHSSVKRSCSQNDSEEPTLSLTSSFGTILRKCSRNETCSNNTVISQDLDYKEAKCNKEKLQL
FITPEADSLSCLQEGQCENDPKSKKVSDIKEEVLAAACHPVQHSKVEYSDTDFQSQKSLLYDHENASTLI
LTPTSKDVLSNLVMISRGKESYKMSDKLKGNNYESDVELTKNIPMEKNQDVCALNENYKNVELLPPEKYM
RVASPSRKVQFNQNTNLRVIQKNQEETTSISKITVNPDSEELFSDNENNFVFQVANERNNLALGNTKELH
ETDLTCVNEPIFKNSTMVLYGDTGDKQATQVSIKKDLVYVLAEENKNSVKQHIKMTLGQDLKSDISLNID
KIPEKNNDYMNKWAGLLGPISNHSFGGSFRTASNKEIKLSEHNIKKSKMFFKDIEEQYPTSLACVEIVNT
LALDNQKKLSKPQSINTVSAHLQSSVVVSDCKNSHITPQMLFSKQDFNSNHNLTPSQKAEITELSTILEE
SGSQFEFTQFRKPSYILQKSTFEVPENQMTILKTTSEECRDADLHVIMNAPSIGQVDSSKQFEGTVEIKR
KFAGLLKNDCNKSASGYLTDENEVGFRGFYSAHGTKLNVSTEALQKAVKLFSDIENISEETSAEVHPISL
SSSKCHDSVVSMFKIENHNDKTVSEKNNKCQLILQNNIEMTTGTFVEEITENYKRNTENEDNKYTAASRN
SHNLEFDGSDSSKNDTVCIHKDETDLLFTDQHNICLKLSGQFMKEGNTQIKEDLSDLTFLEVAKAQEACH
GNTSNKEQLTATKTEQNIKDFETSDTFFQTASGKNISVAKESFNKIVNFFDQKPEELHNFSLNSELHSDI
RKNKMDILSYEETDIVKHKILKESVPVGTGNQLVTFQGQPERDEKIKEPTLLGFHTASGKKVKIAKESLD
KVKNLFDEKEQGTSEITSFSHQWAKTLKYREACKDLELACETIEITAAPKCKEMQNSLNNDKNLVSIETV
VPPKLLSDNLCRQTENLKTSKSIFLKVKVHENVEKETAKSPATCYTNQSPYSVIENSALAFYTSCSRKTS
VSQTSLLEAKKWLREGIFDGQPERINTADYVGNYLYENNSNSTIAENDKNHLSEKQDTYLSNSSMSNSYS
YHSDEVYNDSGYLSKNKLDSGIEPVLKNVEDQKNTSFSKVISNVKDANAYPQTVNEDICVEELVTSSSPC
KNKNAAIKLSISNSNNFEVGPPAFRIASGKIVCVSHETIKKVKDIFTDSFSKVIKENNENKSKICQTKIM
AGCYEALDDSEDILHNSLDNDECSTHSHKVFADIQSEEILQHNQNMSGLEKVSKISPCDVSLETSDICKC
SIGKLHKSVSSANTCGIFSTASGKSVQVSDASLQNARQVFSEIEDSTKQVFSKVLFKSNEHSDQLTREEN
TAIRTPEHLISQKGFSYNVVNSSAFSGFSTASGKQVSILESSLHKVKGVLEEFDLIRTEHSLHYSPTSRQ
NVSKILPRVDKRNPEHCVNSEMEKTCSKEFKLSNNLNVEGGSSENNHSIKVSPYLSQFQQDKQQLVLGTK
VSLVENIHVLGKEQASPKNVKMEIGKTETFSDVPVKTNIEVCSTYSKDSENYFETEAVEIAKAFMEDDEL
TDSKLPSHATHSLFTCPENEEMVLSNSRIGKRRGEPLILVGEPSIKRNLLNEFDRIIENQEKSLKASKST
PDGTIKDRRLFMHHVSLEPITCVPFRTTKERQEIQNPNFTAPGQEFLSKSHLYEHLTLEKSSSNLAVSGH
PFYQVSATRNEKMRHLITTGRPTKVFVPPFKTKSHFHRVEQCVRNINLEENRQKQNIDGHGSDDSKNKIN
DNEIHQFNKNNSNQAAAVTFTKCEEEPLDLITSLQNARDIQDMRIKKKQRQRVFPQPGSLYLAKTSTLPR
ISLKAAVGGQVPSACSHKQLYTYGVSKHCIKINSKNAESFQFHTEDYFGKESLWTGKGIQLADGGWLIPS
NDGKAGKEEFYRALCDTPGVDPKLISRIWVYNHYRWIIWKLAAMECAFPKEFANRCLSPERVLLQLKYRY
DTEIDRSRRSAIKKIMERDDTAAKTLVLCVSDIISLSANISETSSNKTSSADTQKVAIIELTDGWYAVKA
QLDPPLLAVLKNGRLTVGQKIILHGAELVGSPDACTPLEAPESLMLKISANSTRPARWYTKLGFFPDPRP
FPLPLSSLFSDGGNVGCVDVIIQRAYPIQWMEKTSSGLYIFRNEREEEKEAAKYVEAQQKRLEALFTKIQ
EEFEEHEENTTKPYLPSRALTRQQVRALQDGAELYEAVKNAADPAYLEGYFSEEQLRALNNHRQMLNDKK
QAQIQLEIRKAMESAEQKEQGLSRDVTTVWKLRIVSYSKKEKDSVILSIWRPSSDLYSLLTEGKRYRIYH
LATSKSKSKSERANIQLAATKKTQYQQLPVSDEILFQIYQPREPLHFSKFLDPDFQPSCSEVDLIGFVVS
VVKKTGLAPFVYLSDECYNLLAIKFWIDLNEDIIKPHMLIAASNLQWRPESKSGLLTLFAGDFSVFSASP
KEGHFQETFNKMKNTVENIDILCNEAENKLMHILHANDPKWSTPTKDCTSGPYTAQIIPGTGNKLLMSSP
NCEIYYQSPLSLCMAKRKSVSTPVSAQMTSKSCKGEKEIDDQKNCKKRRALDFLSRLPLPPPVSPICTFV
SPAAQKAFQPPRSCGTKYETPIKKKELNSPQMTPFKKFNEISLLESNSIADEELALINTQALLSGSTGEK
QFISVSESTRTAPTSSEDYLRLKRRCTTSLIKEQESSQASTEECEKNKQDTITTKKYI
----refp_db-----
$ formatdb -i refp_db -p T -o T
----tp53.fa-----
>gi|187233964|gb|ACD01221.1| TP53 [Homo sapiens]
RAMAIYKQSQHMTEVVRRCPTNERCSDSDGLAPPQHLIR
----tp53.fa-----
$ blastall -p blastp -i tp53.fa -d refp_db
http://www.ncbi.nlm.nih.gov/staff/tao/URLAPI/unix_setup.html
http://www.ncbi.nlm.nih.gov/staff/tao/URLAPI/blastdb.html
Fasta -> DB
For nucleotide: formatdb -i input_db -p F -o T
For protein: formatdb -i input_db -p T -o T
----refp_db----
>gi|113722133|ref|NP_055861.3| probable helicase senataxin [Homo sapiens]
MSTCCWCTPGGASTIDFLKRYASNTPSGEFQTADEDLCYCLECVAEYHKARDELPFLHEVLWELETLRLI
NHFEKSMKAEIGDDDELYIVDNNGEMPLFDITGQDFENKLRVPLLEILKYPYLLLHERVNELCVEALCRM
EQANCSFQVFDKHPGIYLFLVHPNEMVRRWAILTARNLGKVDRDDYYDLQEVLLCLFKVIELGLLESPDI
YTSSVLEKGKLILLPSHMYDTTNYKSYWLGICMLLTILEEQAMDSLLLGSDKQNDFMQSILHTMEREADD
DSVDPFWPALHCFMVILDRLGSKVWGQLMDPIVAFQTIINNASYNREIRHIRNSSVRTKLEPESYLDDMV
TCSQIVYNYNPEKTKKDSGWRTAICPDYCPNMYEEMETLASVLQSDIGQDMRVHNSTFLWFIPFVQSLMD
LKDLGVAYIAQVVNHLYSEVKEVLNQTDAVCDKVTEFFLLILVSVIELHRNKKCLHLLWVSSQQWVEAVV
KCAKLPTTAFTRSSEKSSGNCSKGTAMISSLSLHSMPSNSVQLAYVQLIRSLLKEGYQLGQQSLCKRFWD
KLNLFLRGNLSLGWQLTSQETHELQSCLKQIIRNIKFKAPPCNTFVDLTSACKISPASYNKEESEQMGKT
SRKDMHCLEASSPTFSKEPMKVQDSVLIKADNTIEGDNNEQNYIKDVKLEDHLLAGSCLKQSSKNIFTER
AEDQIKISTRKQKSVKEISSYTPKDCTSRNGPERGCDRGIIVSTRLLTDSSTDALEKVSTSNEDFSLKDD
ALAKTSKRKTKVQKDEICAKLSHVIKKQHRKSTLVDNTINLDENLTVSNIESFYSRKDTGVQKGDGFIHN
LSLDPSGVLDDKNGEQKSQNNVLPKEKQLKNEELVIFSFHENNCKIQEFHVDGKELIPFTEMTNASEKKS
SPFKDLMTVPESRDEEMSNSTSVIYSNLTREQAPDISPKSDTLTDSQIDRDLHKLSLLAQASVITFPSDS
PQNSSQLQRKVKEDKRCFTANQNNVGDTSRGQVIIISDSDDDDDERILSLEKLTKQDKICLEREHPEQHV
STVNSKEEKNPVKEEKTETLFQFEESDSQCFEFESSSEVFSVWQDHPDDNNSVQDGEKKCLAPIANTTNG
QGCTDYVSEVVKKGAEGIEEHTRPRSISVEEFCEIEVKKPKRKRSEKPMAEDPVRPSSSVRNEGQSDTNK
RDLVGNDFKSIDRRTSTPNSRIQRATTVSQKKSSKLCTCTEPIRKVPVSKTPKKTHSDAKKGQNRSSNYL
SCRTTPAIVPPKKFRQCPEPTSTAEKLGLKKGPRKAYELSQRSLDYVAQLRDHGKTVGVVDTRKKTKLIS
PQNLSVRNNKKLLTSQELQMQRQIRPKSQKNRRRLSDCESTDVKRAGSHTAQNSDIFVPESDRSDYNCTG
GTEVLANSNRKQLIKCMPSEPETIKAKHGSPATDDACPLNQCDSVVLNGTVPTNEVIVSTSEDPLGGGDP
TARHIEMAALKEGEPDSSSDAEEDNLFLTQNDPEDMDLCSQMENDNYKLIELIHGKDTVEVEEDSVSRPQ
LESLSGTKCKYKDCLETTKNQGEYCPKHSEVKAADEDVFRKPGLPPPASKPLRPTTKIFSSKSTSRIAGL
SKSLETSSALSPSLKNKSKGIQSILKVPQPVPLIAQKPVGEMKNSCNVLHPQSPNNSNRQGCKVPFGESK
YFPSSSPVNILLSSQSVSDTFVKEVLKWKYEMFLNFGQCGPPASLCQSISRPVPVRFHNYGDYFNVFFPL
MVLNTFETVAQEWLNSPNRENFYQLQVRKFPADYIKYWEFAVYLEECELAKQLYPKENDLVFLAPERINE
EKKDTERNDIQDLHEYHSGYVHKFRRTSVMRNGKTECYLSIQTQENFPANLNELVNCIVISSLVTTQRKL
KAMSLLGSRNQLARAVLNPNPMDFCTKDLLTTTSERIIAYLRDFNEDQKKAIETAYAMVKHSPSVAKICL
IHGPPGTGKSKTIVGLLYRLLTENQRKGHSDENSNAKIKQNRVLVCAPSNAAVDELMKKIILEFKEKCKD
KKNPLGNCGDINLVRLGPEKSINSEVLKFSLDSQVNHRMKKELPSHVQAMHKRKEFLDYQLDELSRQRAL
CRGGREIQRQELDENISKVSKERQELASKIKEVQGRPQKTQSIIILESHIICCTLSTSGGLLLESAFRGQ
GGVPFSCVIVDEAGQSCEIETLTPLIHRCNKLILVGDPKQLPPTVISMKAQEYGYDQSMMARFCRLLEEN
VEHNMISRLPILQLTVQYRMHPDICLFPSNYVYNRNLKTNRQTEAIRCSSDWPFQPYLVFDVGDGSERRD
NDSYINVQEIKLVMEIIKLIKDKRKDVSFRNIGIITHYKAQKTMIQKDLDKEFDRKGPAEVDTVDAFQGR
QKDCVIVTCVRANSIQGSIGFLASLQRLNVTITRAKYSLFILGHLRTLMENQHWNQLIQDAQKRGAIIKT
CDKNYRHDAVKILKLKPVLQRSLTHPPTIAPEGSRPQGGLPSSKLDSGFAKTSVAASLYHTPSDSKEITL
TVTSKDPERPPVHDQLQDPRLLKRMGIEVKGGIFLWDPQPSSPQHPGATPPTGEPGFPVVHQDLSHIQQP
AAVVAALSSHKPPVRGEPPAASPEASTCQSKCDDPEEELCHRREARAFSEGEQEKCGSETHHTRRNSRWD
KRTLEQEDSSSKKRKLL
>gi|187233964|gb|ACD01221.1| TP53 [Homo sapiens]
RAMAIYKQSQHMTEVVRRCPTNERCSDSDGLAPPQHLIR
>gi|119395734|ref|NP_000050.2| breast cancer type 2 susceptibility protein [Homo sapiens]
MPIGSKERPTFFEIFKTRCNKADLGPISLNWFEELSSEAPPYNSEPAEESEHKNNNYEPNLFKTPQRKPS
YNQLASTPIIFKEQGLTLPLYQSPVKELDKFKLDLGRNVPNSRHKSLRTVKTKMDQADDVSCPLLNSCLS
ESPVVLQCTHVTPQRDKSVVCGSLFHTPKFVKGRQTPKHISESLGAEVDPDMSWSSSLATPPTLSSTVLI
VRNEEASETVFPHDTTANVKSYFSNHDESLKKNDRFIASVTDSENTNQREAASHGFGKTSGNSFKVNSCK
DHIGKSMPNVLEDEVYETVVDTSEEDSFSLCFSKCRTKNLQKVRTSKTRKKIFHEANADECEKSKNQVKE
KYSFVSEVEPNDTDPLDSNVANQKPFESGSDKISKEVVPSLACEWSQLTLSGLNGAQMEKIPLLHISSCD
QNISEKDLLDTENKRKKDFLTSENSLPRISSLPKSEKPLNEETVVNKRDEEQHLESHTDCILAVKQAISG
TSPVASSFQGIKKSIFRIRESPKETFNASFSGHMTDPNFKKETEASESGLEIHTVCSQKEDSLCPNLIDN
GSWPATTTQNSVALKNAGLISTLKKKTNKFIYAIHDETSYKGKKIPKDQKSELINCSAQFEANAFEAPLT
FANADSGLLHSSVKRSCSQNDSEEPTLSLTSSFGTILRKCSRNETCSNNTVISQDLDYKEAKCNKEKLQL
FITPEADSLSCLQEGQCENDPKSKKVSDIKEEVLAAACHPVQHSKVEYSDTDFQSQKSLLYDHENASTLI
LTPTSKDVLSNLVMISRGKESYKMSDKLKGNNYESDVELTKNIPMEKNQDVCALNENYKNVELLPPEKYM
RVASPSRKVQFNQNTNLRVIQKNQEETTSISKITVNPDSEELFSDNENNFVFQVANERNNLALGNTKELH
ETDLTCVNEPIFKNSTMVLYGDTGDKQATQVSIKKDLVYVLAEENKNSVKQHIKMTLGQDLKSDISLNID
KIPEKNNDYMNKWAGLLGPISNHSFGGSFRTASNKEIKLSEHNIKKSKMFFKDIEEQYPTSLACVEIVNT
LALDNQKKLSKPQSINTVSAHLQSSVVVSDCKNSHITPQMLFSKQDFNSNHNLTPSQKAEITELSTILEE
SGSQFEFTQFRKPSYILQKSTFEVPENQMTILKTTSEECRDADLHVIMNAPSIGQVDSSKQFEGTVEIKR
KFAGLLKNDCNKSASGYLTDENEVGFRGFYSAHGTKLNVSTEALQKAVKLFSDIENISEETSAEVHPISL
SSSKCHDSVVSMFKIENHNDKTVSEKNNKCQLILQNNIEMTTGTFVEEITENYKRNTENEDNKYTAASRN
SHNLEFDGSDSSKNDTVCIHKDETDLLFTDQHNICLKLSGQFMKEGNTQIKEDLSDLTFLEVAKAQEACH
GNTSNKEQLTATKTEQNIKDFETSDTFFQTASGKNISVAKESFNKIVNFFDQKPEELHNFSLNSELHSDI
RKNKMDILSYEETDIVKHKILKESVPVGTGNQLVTFQGQPERDEKIKEPTLLGFHTASGKKVKIAKESLD
KVKNLFDEKEQGTSEITSFSHQWAKTLKYREACKDLELACETIEITAAPKCKEMQNSLNNDKNLVSIETV
VPPKLLSDNLCRQTENLKTSKSIFLKVKVHENVEKETAKSPATCYTNQSPYSVIENSALAFYTSCSRKTS
VSQTSLLEAKKWLREGIFDGQPERINTADYVGNYLYENNSNSTIAENDKNHLSEKQDTYLSNSSMSNSYS
YHSDEVYNDSGYLSKNKLDSGIEPVLKNVEDQKNTSFSKVISNVKDANAYPQTVNEDICVEELVTSSSPC
KNKNAAIKLSISNSNNFEVGPPAFRIASGKIVCVSHETIKKVKDIFTDSFSKVIKENNENKSKICQTKIM
AGCYEALDDSEDILHNSLDNDECSTHSHKVFADIQSEEILQHNQNMSGLEKVSKISPCDVSLETSDICKC
SIGKLHKSVSSANTCGIFSTASGKSVQVSDASLQNARQVFSEIEDSTKQVFSKVLFKSNEHSDQLTREEN
TAIRTPEHLISQKGFSYNVVNSSAFSGFSTASGKQVSILESSLHKVKGVLEEFDLIRTEHSLHYSPTSRQ
NVSKILPRVDKRNPEHCVNSEMEKTCSKEFKLSNNLNVEGGSSENNHSIKVSPYLSQFQQDKQQLVLGTK
VSLVENIHVLGKEQASPKNVKMEIGKTETFSDVPVKTNIEVCSTYSKDSENYFETEAVEIAKAFMEDDEL
TDSKLPSHATHSLFTCPENEEMVLSNSRIGKRRGEPLILVGEPSIKRNLLNEFDRIIENQEKSLKASKST
PDGTIKDRRLFMHHVSLEPITCVPFRTTKERQEIQNPNFTAPGQEFLSKSHLYEHLTLEKSSSNLAVSGH
PFYQVSATRNEKMRHLITTGRPTKVFVPPFKTKSHFHRVEQCVRNINLEENRQKQNIDGHGSDDSKNKIN
DNEIHQFNKNNSNQAAAVTFTKCEEEPLDLITSLQNARDIQDMRIKKKQRQRVFPQPGSLYLAKTSTLPR
ISLKAAVGGQVPSACSHKQLYTYGVSKHCIKINSKNAESFQFHTEDYFGKESLWTGKGIQLADGGWLIPS
NDGKAGKEEFYRALCDTPGVDPKLISRIWVYNHYRWIIWKLAAMECAFPKEFANRCLSPERVLLQLKYRY
DTEIDRSRRSAIKKIMERDDTAAKTLVLCVSDIISLSANISETSSNKTSSADTQKVAIIELTDGWYAVKA
QLDPPLLAVLKNGRLTVGQKIILHGAELVGSPDACTPLEAPESLMLKISANSTRPARWYTKLGFFPDPRP
FPLPLSSLFSDGGNVGCVDVIIQRAYPIQWMEKTSSGLYIFRNEREEEKEAAKYVEAQQKRLEALFTKIQ
EEFEEHEENTTKPYLPSRALTRQQVRALQDGAELYEAVKNAADPAYLEGYFSEEQLRALNNHRQMLNDKK
QAQIQLEIRKAMESAEQKEQGLSRDVTTVWKLRIVSYSKKEKDSVILSIWRPSSDLYSLLTEGKRYRIYH
LATSKSKSKSERANIQLAATKKTQYQQLPVSDEILFQIYQPREPLHFSKFLDPDFQPSCSEVDLIGFVVS
VVKKTGLAPFVYLSDECYNLLAIKFWIDLNEDIIKPHMLIAASNLQWRPESKSGLLTLFAGDFSVFSASP
KEGHFQETFNKMKNTVENIDILCNEAENKLMHILHANDPKWSTPTKDCTSGPYTAQIIPGTGNKLLMSSP
NCEIYYQSPLSLCMAKRKSVSTPVSAQMTSKSCKGEKEIDDQKNCKKRRALDFLSRLPLPPPVSPICTFV
SPAAQKAFQPPRSCGTKYETPIKKKELNSPQMTPFKKFNEISLLESNSIADEELALINTQALLSGSTGEK
QFISVSESTRTAPTSSEDYLRLKRRCTTSLIKEQESSQASTEECEKNKQDTITTKKYI
----refp_db-----
$ formatdb -i refp_db -p T -o T
----tp53.fa-----
>gi|187233964|gb|ACD01221.1| TP53 [Homo sapiens]
RAMAIYKQSQHMTEVVRRCPTNERCSDSDGLAPPQHLIR
----tp53.fa-----
$ blastall -p blastp -i tp53.fa -d refp_db
Fix broken packages
Probably mixed ubuntu distributions, ie jaunty and intrepid
Check
$ sudo vi /etc/apt/sources.list
and remove jaunty
$ sudo apt-get install autoremove
$ sudo apt-get -f install xine-ui vlc mplayer
$ sudo apt-get build-dep mplayer meconder
Check
$ sudo vi /etc/apt/sources.list
and remove jaunty
$ sudo apt-get install autoremove
$ sudo apt-get -f install xine-ui vlc mplayer
$ sudo apt-get build-dep mplayer meconder
Monday, March 8, 2010
Quick programming reference
C++
http://www.stumbleupon.com/su/3dhSXA/www.sourcepole.com/sources/programming/cpp/cppqref.html
Perl
http://www.doulos.com/knowhow/perl/quick_start/
http://www.stumbleupon.com/su/3dhSXA/www.sourcepole.com/sources/programming/cpp/cppqref.html
Perl
http://www.doulos.com/knowhow/perl/quick_start/
Writing scalable applications
http://msdn.microsoft.com/en-us/library/ms810434.aspx
http://code.google.com/appengine/articles/scaling/overview.html
* Minimizing work - Retrieve objects/entities by key, key name, or ID, Paging results, read / write sparsely
* Paging through large datasets
* Avoiding datastore contention
* Sharding counters
* Effective memcache
http://msdn.microsoft.com/en-us/magazine/cc163854.aspx#S4
Performance on the Data Tier
Tip 1—Return Multiple Resultsets
Tip 2—Paged Data Access
Tip 3—Connection Pooling
Tip 4—ASP.NET Cache API
Tip 5—Per-Request Caching
Tip 6—Background Processing
Tip 7—Page Output Caching and Proxy Servers
Tip 8—Run IIS 6.0 (If Only for Kernel Caching)
Tip 9—Use Gzip Compression
Tip 10—Server Control View State
Conclusion
http://www.javaperformancetuning.com/tips/design.shtml#REF2
J2EE Patterns
MVC http://java.sun.com/blueprints/patterns/MVC-detailed.html
http://java.sun.com/blueprints/patterns/catalog.html
http://code.google.com/appengine/articles/scaling/overview.html
* Minimizing work - Retrieve objects/entities by key, key name, or ID, Paging results, read / write sparsely
* Paging through large datasets
* Avoiding datastore contention
* Sharding counters
* Effective memcache
http://msdn.microsoft.com/en-us/magazine/cc163854.aspx#S4
Performance on the Data Tier
Tip 1—Return Multiple Resultsets
Tip 2—Paged Data Access
Tip 3—Connection Pooling
Tip 4—ASP.NET Cache API
Tip 5—Per-Request Caching
Tip 6—Background Processing
Tip 7—Page Output Caching and Proxy Servers
Tip 8—Run IIS 6.0 (If Only for Kernel Caching)
Tip 9—Use Gzip Compression
Tip 10—Server Control View State
Conclusion
http://www.javaperformancetuning.com/tips/design.shtml#REF2
J2EE Patterns
MVC http://java.sun.com/blueprints/patterns/MVC-detailed.html
http://java.sun.com/blueprints/patterns/catalog.html
Sunday, March 7, 2010
Pokemon Top abilities
http://www.smogon.com/smog/issue4/top_abilities
480 spd-def-a Lopunny normal wk: fighting
525 sa-a Lucario fight/steel wk: fire/fighting/ground
545 sa-sd Togekiss normal/flying wk: rock / elec / ice
480 sa/a Octillery water wk: grass / elec
540 hp-sp.def-sp.a Blissey normal wk: fighting
510 def-a Gliscor ground/flying wk: ice / water
525 a-def Torterra grass/ground
480 spd Froslass ice
525 sp-a Glaceon ice
600 Garchomp dragon/ground wk: dragon/ice, special
500 sp-a Wailord water
425 sp-a chimecho psychic
http://www.youtube.com/watch?v=aFUV6N9ZIys
Battle vs Synthia
http://www.youtube.com/watch?v=S6tBB1ksgLc&feature=fvsr
Types
http://www.smogon.com/dp/types/
HM Slave - Gyrados, Bibarel, Tropius, Skarmory
http://bulbapedia.bulbagarden.net/wiki/Appendix:HM_slave
Where To Find Good Rod In Pokemon Platinum?
U can find the good rod on route 209 east from hearthome city :}
Where do you get a Super Rod on Pokemon Platinum?
Find a fisherman in the Fight Area. You need to have the National Dex. It is at the northeast exit (top left).
POKEMON PLATINUM: HOW TO GET REMORAID?
You need to fish with the Good Rod on Route 212 South, Route 213, Route 222, Route 223, Route 224, Route 230, Pastoria City, Sunyshore City, or at the Pokemon League. It is common and should be easy to catch
Hustle increases the user's Attack stat by 50%, but lowers the Accuracy of the user's Physical moves by 20%. Special moves are unaffected by Hustle.
http://www.smogon.com/dp/pokemon/octillery
Sniper multiplies the base power of an attack 1.5× during a critical hit.
List of Pokemon with Unique Type combinations
http://bulbapedia.bulbagarden.net/wiki/List_of_Pok%C3%A9mon_with_unique_type_combinations
http://bulbapedia.bulbagarden.net/wiki/Happiness
Hidden Power?
However, in Platinum, there is a man in the Veilstone Game Corner Prize Exchange house that will tell the player the type of their Pokémon's Hidden Power. In HeartGold and SoulSilver, he is present in the Celadon Game Corner Prize Exchange house
http://bulbapedia.bulbagarden.net/wiki/Hidden_Power_(move)
Honey (wait 6 1/4 hours)
http://bulbapedia.bulbagarden.net/wiki/Honey
http://wiki.answers.com/Q/What_do_you_have_to_do_when_you_have_put_honey_on_a_tree_on_pokemon_diamond
Soft reset DS
heyy! heres how to SR a DS L + R + Select + Start and .... HOLD!!
Pokemon tips / cheats
http://www.neoseeker.com/Games/cheats/DS/pokemon_platinum.html
Nature
Lonely: +attack, -defense
Brave: +attack, -speed
Adamant: +attack, -special attack
Naughty: +attack, -special defense
Bold: +defense, -attack
Relaxed: +defense, -defense
Impish: +defense, -special attack
Lax: +defense, -special defense
Timid: +speed, -attack
Hasty: +speed, -defense
Jolly: +speed, -special attack
Naive: +speed, -special defense
Modest: +special attack, -attack
Mild: +special attack, -defense
Quiet: +special attack, -speed
Rash: +special attack, -special defense
Calm: +special defense, -attack
Careful: +special defense, -special attack
Gentle: +special defense, -defense
Sassy: +special defense, -speed
Hardy: Neutral
Docile: Neutral
Serious: Neutral
Bashful: Neutral
Quirky: Neutral
obtain trade evolution pokemon
Obtain Trade-Evolution Pokemon
Pokemon such as Graveler, Haunter, Machoke, and Kadabra will only evolve when traded. You can use this trick to evolve these Pokemon using only a single DS.
Requirements:
Must have access to GTS
Must have Wi-Fi
1. Head to the GTS in Jubilife City with the Pokemon you want to evolve.
2. Deposit your Pokemon in the GTS. Request something that is IMPOSSIBLE or very rare to get, to decrease the chances of your Pokemon being traded. If your deposited Pokemon is traded, the trick will fail.
3. Seek for a Pokemon on the GTS and make any trade.
4. Once you finish the trade, withdraw the Pokemon you had deposited in the GTS. If you did the trick right, it should evolve as if it was traded.
You can do this trick with any Pokemon that is evolved through trading.
480 spd-def-a Lopunny normal wk: fighting
525 sa-a Lucario fight/steel wk: fire/fighting/ground
545 sa-sd Togekiss normal/flying wk: rock / elec / ice
480 sa/a Octillery water wk: grass / elec
540 hp-sp.def-sp.a Blissey normal wk: fighting
510 def-a Gliscor ground/flying wk: ice / water
525 a-def Torterra grass/ground
480 spd Froslass ice
525 sp-a Glaceon ice
600 Garchomp dragon/ground wk: dragon/ice, special
500 sp-a Wailord water
425 sp-a chimecho psychic
http://www.youtube.com/watch?v=aFUV6N9ZIys
Battle vs Synthia
http://www.youtube.com/watch?v=S6tBB1ksgLc&feature=fvsr
Types
http://www.smogon.com/dp/types/
HM Slave - Gyrados, Bibarel, Tropius, Skarmory
http://bulbapedia.bulbagarden.net/wiki/Appendix:HM_slave
Where To Find Good Rod In Pokemon Platinum?
U can find the good rod on route 209 east from hearthome city :}
Where do you get a Super Rod on Pokemon Platinum?
Find a fisherman in the Fight Area. You need to have the National Dex. It is at the northeast exit (top left).
POKEMON PLATINUM: HOW TO GET REMORAID?
You need to fish with the Good Rod on Route 212 South, Route 213, Route 222, Route 223, Route 224, Route 230, Pastoria City, Sunyshore City, or at the Pokemon League. It is common and should be easy to catch
Hustle increases the user's Attack stat by 50%, but lowers the Accuracy of the user's Physical moves by 20%. Special moves are unaffected by Hustle.
http://www.smogon.com/dp/pokemon/octillery
Sniper multiplies the base power of an attack 1.5× during a critical hit.
List of Pokemon with Unique Type combinations
http://bulbapedia.bulbagarden.net/wiki/List_of_Pok%C3%A9mon_with_unique_type_combinations
http://bulbapedia.bulbagarden.net/wiki/Happiness
Hidden Power?
However, in Platinum, there is a man in the Veilstone Game Corner Prize Exchange house that will tell the player the type of their Pokémon's Hidden Power. In HeartGold and SoulSilver, he is present in the Celadon Game Corner Prize Exchange house
http://bulbapedia.bulbagarden.net/wiki/Hidden_Power_(move)
Honey (wait 6 1/4 hours)
http://bulbapedia.bulbagarden.net/wiki/Honey
http://wiki.answers.com/Q/What_do_you_have_to_do_when_you_have_put_honey_on_a_tree_on_pokemon_diamond
Soft reset DS
heyy! heres how to SR a DS L + R + Select + Start and .... HOLD!!
Pokemon tips / cheats
http://www.neoseeker.com/Games/cheats/DS/pokemon_platinum.html
Nature
Lonely: +attack, -defense
Brave: +attack, -speed
Adamant: +attack, -special attack
Naughty: +attack, -special defense
Bold: +defense, -attack
Relaxed: +defense, -defense
Impish: +defense, -special attack
Lax: +defense, -special defense
Timid: +speed, -attack
Hasty: +speed, -defense
Jolly: +speed, -special attack
Naive: +speed, -special defense
Modest: +special attack, -attack
Mild: +special attack, -defense
Quiet: +special attack, -speed
Rash: +special attack, -special defense
Calm: +special defense, -attack
Careful: +special defense, -special attack
Gentle: +special defense, -defense
Sassy: +special defense, -speed
Hardy: Neutral
Docile: Neutral
Serious: Neutral
Bashful: Neutral
Quirky: Neutral
obtain trade evolution pokemon
Obtain Trade-Evolution Pokemon
Pokemon such as Graveler, Haunter, Machoke, and Kadabra will only evolve when traded. You can use this trick to evolve these Pokemon using only a single DS.
Requirements:
Must have access to GTS
Must have Wi-Fi
1. Head to the GTS in Jubilife City with the Pokemon you want to evolve.
2. Deposit your Pokemon in the GTS. Request something that is IMPOSSIBLE or very rare to get, to decrease the chances of your Pokemon being traded. If your deposited Pokemon is traded, the trick will fail.
3. Seek for a Pokemon on the GTS and make any trade.
4. Once you finish the trade, withdraw the Pokemon you had deposited in the GTS. If you did the trick right, it should evolve as if it was traded.
You can do this trick with any Pokemon that is evolved through trading.
Friday, March 5, 2010
Thursday, March 4, 2010
First Order Logic - FOL
Propositional logic is declarative but not expressive, hence we have First Order Logic (FOL), also called Predicate Calculus
Has quantifiers, universal ∀x (usually use ->), existential ∃x (usually use ^)
∃x ∀y is not the same as ∀y ∃x
∃x ∀y Loves(x,y)
“There is a person who loves everyone in the world”
∀y ∃x Loves(x,y)
“Everyone in the world is loved by at least one person”
∀x Likes(x,IceCream) = ¬∃x ¬Likes(x,IceCream)
kinship domain:
object are people
Properties include gender and they are related by relations
such as parenthood, brotherhood,marriage
predicates: Male, Female (unary)
Parent,Sibling,Daughter,Son...
Function:Mother Father
{a/Shoot} <- substitution
Has quantifiers, universal ∀x (usually use ->), existential ∃x (usually use ^)
∃x ∀y is not the same as ∀y ∃x
∃x ∀y Loves(x,y)
“There is a person who loves everyone in the world”
∀y ∃x Loves(x,y)
“Everyone in the world is loved by at least one person”
∀x Likes(x,IceCream) = ¬∃x ¬Likes(x,IceCream)
kinship domain:
object are people
Properties include gender and they are related by relations
such as parenthood, brotherhood,marriage
predicates: Male, Female (unary)
Parent,Sibling,Daughter,Son...
Function:Mother Father
{a/Shoot} <- substitution
Rule Based Reasoning
Entailment means that one thing follows from another:
KB ╞ α
Propositional Logic
--------------------
The proposition symbols P1, P2 etc are sentences
conjunction ^
disjunction V
implication (if-then) a -> b ≡ ~a V b // false iff a=T and b=F
biconditional a <-> b ≡ (a->b) ^ (b->a)
logically equivalent α ≡ ß iff α╞ β and β╞α
for:
1. (a ^ b) V (c V d)
2. (a V c V d) ^ (b V c V d)
We say we pick all the operand and operators after "a" except "^ b" since we are distributing over "^" in phrase "^ b" i.e. "a" operates on "V (c V d)" and "b" operates on the same phrase and the final operator is "^" which will go in the middle.
The same is true for the second example you mentioned...
1. (a ^ b) V (c ^ d) // Distribute over "^" in "a^b"
2. (a V (c ^ d)) ^ (b V (c ^ d)) // Expand
3. ((a V c)^(a V d)) ^ ((b V c)^(b V d)) // all operators outside parentheses are of type "^" so good to remove extra ones
4. (a V c) ^ (a V d) ^ (b V c) ^ (b V d)

A sentence is valid if it is true in all models (truth tables where α=True),
Validity is connected to inference via the Deduction Theorem:
KB ╞ α if and only if (KB ⇒ α) is valid
A sentence is satisfiable if it is true in some model
A sentence is unsatisfiable if it is true in no models
Satisfiability is connected to inference via the following:
KB ╞ α if and only if (KB ∧¬α) is unsatisfiable [] (empty clause)
Interpretation: any assignment of true and false to atoms
Rules of inference

Model checking
⌧truth table enumeration (always exponential in n)
⌧improved backtracking, e.g., Davis--Putnam-Logemann-Loveland (DPLL), Backtracking with constraint propagation, backjumping.
⌧heuristic search in model space (sound but incomplete)
e.g., min-conflicts-like hill-climbing algorithms
Resolution is sound
Resolution is NOT complete:
P and R entails P V R but you cannot infer P V R From (P and R) by resolution
Resolution is complete for refutation: adding (¬P) and (¬R) to (P and R) we can infer the empty clause. (proof by contradiction)
CNF = conjunctive normal form eg. (A V B) ^ C
( P ∧ ¬Q ) ∨ ( ¬R ∨ P ) ≡ ( P ∨ ¬ R ∨ P ) ∧ ( ¬ Q ∨ ¬R ∨ P ) ≡ ( P ∨ ¬R ), (¬Q ∨ ¬R ∨ P )
The set of support: those clauses coming from negation of the theorem or their decendents.
Horn clause: Eg C ^ (B -> A) ^ ( C ^ D -> B) NOT! (C V D -> B)
Forward chaining (data driven) - linear time
Idea: fire any rule whose premises are satisfied in the KB,
add its conclusion to the KB, until query is found
Backward chaining (goal driven) - linear time
Idea: work backwards from the query q:
to prove q by BC,
check if q is known already, or
prove by BC all premises of some rule concluding q
Avoid loops: check if new subgoal is already on the goal stack
Avoid repeated work: check if new subgoal
1. has already been proved true, or
2. has already failed
Efficient propositional inference:
- DPLL 1. early termination 2. purse symbol (same sign for everywhere, so either all nots or positives) 3. unit clause - clause with only a literal
- WalkSAT (incomplete), local search using randomness
KB ╞ α
Propositional Logic
--------------------
The proposition symbols P1, P2 etc are sentences
conjunction ^
disjunction V
implication (if-then) a -> b ≡ ~a V b // false iff a=T and b=F
biconditional a <-> b ≡ (a->b) ^ (b->a)
logically equivalent α ≡ ß iff α╞ β and β╞α
for:
1. (a ^ b) V (c V d)
2. (a V c V d) ^ (b V c V d)
We say we pick all the operand and operators after "a" except "^ b" since we are distributing over "^" in phrase "^ b" i.e. "a" operates on "V (c V d)" and "b" operates on the same phrase and the final operator is "^" which will go in the middle.
The same is true for the second example you mentioned...
1. (a ^ b) V (c ^ d) // Distribute over "^" in "a^b"
2. (a V (c ^ d)) ^ (b V (c ^ d)) // Expand
3. ((a V c)^(a V d)) ^ ((b V c)^(b V d)) // all operators outside parentheses are of type "^" so good to remove extra ones
4. (a V c) ^ (a V d) ^ (b V c) ^ (b V d)

A sentence is valid if it is true in all models (truth tables where α=True),
Validity is connected to inference via the Deduction Theorem:
KB ╞ α if and only if (KB ⇒ α) is valid
A sentence is satisfiable if it is true in some model
A sentence is unsatisfiable if it is true in no models
Satisfiability is connected to inference via the following:
KB ╞ α if and only if (KB ∧¬α) is unsatisfiable [] (empty clause)
Interpretation: any assignment of true and false to atoms
Rules of inference

Model checking
⌧truth table enumeration (always exponential in n)
⌧improved backtracking, e.g., Davis--Putnam-Logemann-Loveland (DPLL), Backtracking with constraint propagation, backjumping.
⌧heuristic search in model space (sound but incomplete)
e.g., min-conflicts-like hill-climbing algorithms
Resolution is sound
Resolution is NOT complete:
P and R entails P V R but you cannot infer P V R From (P and R) by resolution
Resolution is complete for refutation: adding (¬P) and (¬R) to (P and R) we can infer the empty clause. (proof by contradiction)
CNF = conjunctive normal form eg. (A V B) ^ C
( P ∧ ¬Q ) ∨ ( ¬R ∨ P ) ≡ ( P ∨ ¬ R ∨ P ) ∧ ( ¬ Q ∨ ¬R ∨ P ) ≡ ( P ∨ ¬R ), (¬Q ∨ ¬R ∨ P )
The set of support: those clauses coming from negation of the theorem or their decendents.
Horn clause: Eg C ^ (B -> A) ^ ( C ^ D -> B) NOT! (C V D -> B)
Forward chaining (data driven) - linear time
Idea: fire any rule whose premises are satisfied in the KB,
add its conclusion to the KB, until query is found
Backward chaining (goal driven) - linear time
Idea: work backwards from the query q:
to prove q by BC,
check if q is known already, or
prove by BC all premises of some rule concluding q
Avoid loops: check if new subgoal is already on the goal stack
Avoid repeated work: check if new subgoal
1. has already been proved true, or
2. has already failed
Efficient propositional inference:
- DPLL 1. early termination 2. purse symbol (same sign for everywhere, so either all nots or positives) 3. unit clause - clause with only a literal
- WalkSAT (incomplete), local search using randomness
Ch. 5 - Game Playing - games
Minimax
eg. chess, othello, backgammon (chance node due to Dice, use Expecti-minimax), tic-tac-toe, Grundy's game
- complete, optimal, like DFS: time complexity - O(b^m), space complexity O(bm)
- players take turn, max-min-max-min-max etc.
An Evaluation Function:
- Estimates how good the current board configuration is for a player.
- linear weighted sum of features eg. Eval(s) = w1f1(s) + w2f2(s) + ... + wnfn(s)
f1 = number of white queens - number of black queens
Ply - number of look-ahead levels
Aplha(max of children)-beta(min of children) pruning
- in practice alpha-beta pruning, often get O(b^(d/2)) rather than O(b^d) remember b^(1/2) = sqrt(b)

Expectiminimax - use weights that are linear due to average score, ie. Sum(prob_state*score), Dice has 21 (1+2+3+4+...+6 = n*(n+1)/2 = 6*7/2 http://polysum.tripod.com/) unique dice rolls (6-5 is the same as rolling 5-6)
eg. chess, othello, backgammon (chance node due to Dice, use Expecti-minimax), tic-tac-toe, Grundy's game
- complete, optimal, like DFS: time complexity - O(b^m), space complexity O(bm)
- players take turn, max-min-max-min-max etc.
An Evaluation Function:
- Estimates how good the current board configuration is for a player.
- linear weighted sum of features eg. Eval(s) = w1f1(s) + w2f2(s) + ... + wnfn(s)
f1 = number of white queens - number of black queens
Ply - number of look-ahead levels
Aplha(max of children)-beta(min of children) pruning
- in practice alpha-beta pruning, often get O(b^(d/2)) rather than O(b^d) remember b^(1/2) = sqrt(b)

Expectiminimax - use weights that are linear due to average score, ie. Sum(prob_state*score), Dice has 21 (1+2+3+4+...+6 = n*(n+1)/2 = 6*7/2 http://polysum.tripod.com/) unique dice rolls (6-5 is the same as rolling 5-6)
Nintendo DS Games for the Brain
Brain Age Part 1 and 2 Bundle For Nintendo DS. Train Your Brain!
Professor Layton
Brain Challenge
Flash Focus
Big Brain Academy
Ultimate Brain Games
Brain Challenge
Left Brain Right Brain
---------------------
Others
http://www.mrbass.org/nintendoDS/games/
My Japanese Coach
Lunar Knights
Professor Layton
Brain Challenge
Flash Focus
Big Brain Academy
Ultimate Brain Games
Brain Challenge
Left Brain Right Brain
---------------------
Others
http://www.mrbass.org/nintendoDS/games/
My Japanese Coach
Lunar Knights
Wednesday, March 3, 2010
Constraint Satisfaction Problems - CSP
• The constraint network model
– Variables, domains, constraints, constraint graph, solutions
• Examples:
– graph-coloring, 8-queen, cryptarithmetic, crossword puzzles, vision
problems,scheduling, design
• The search space and naive backtracking,
• The constraint graph (nodes=variables, edges=constraints, solution=assignment of value to variable such that constraint is not violated)
• Like DFS, go deep, called backtracking search
- state = assignment of values to variables while constraints are satisfied
- operator = assignment to next variable such that constraints are not violated
- goal = consistent assignment of all variables
- depends on variable ordering, so d={z,x,y} gives different tree when d={x,y,z}
Maybe:
• Consistency enforcing algorithms
– arc-consistency, AC-1,AC-3
Eg. map-coloring
variables - locations / countries / regions
values - colors in domain of red, green, blue
constraints - adjacent countries are colored differently
graph - nodes are variables (locations), edges are constraints so put an edge between two adjacent regions
Eg. 9x9 sudoku
variables - cells / squares that hold numbers, 81 variables for 9x9 problem
values - numbers in domain 1 to 9
constraints (27 constraints) -
a) each row has unique numbers ie all numbers from 1 to 9, 'Not-equal', AllDiff(a11, a12, a13, ..., a19) - 9 constraints
b) each col has unique numbers ie all numbers from 1 to 9, AllDiff(a11, a21, a22, ..., a29) - 9 constraints
c) each 3x3 grid (9 of them) sums contains all numbers from 1 to 9 - AllDiff(a11, a12, a13, a21, a22, a23, a31, a32, a33) 9 constraints
Eg. Four queen
variables - rows (x1, x2, x3, x4)
values - columns {1,2,3,4}
constraint ((4 choose 2) = 6 constraints)
- graph - (x1-x2), (x1-x3), (x1-x4), ..., (x4-x2), (x4-x3) (a box with a cross inside)
- so each variable constrains all other variables
Look-ahead schemes:
• Value ordering/pruning (choose a least restricting value),
• Variable ordering (choose the most constraining variable)
• Constraint propagation (take decision implications forward)
Heuristics:
1. Minimum Remaining Values (MRV) heuristic - choose the variable with the fewest legal values
2. Degree heuristic: MRV tie breaker, choose the variable with the most constraints on remaining variables
3. Given a variable, choose the least constraining value:
– the one that rules out the fewest values in the remaining variables
4. min-conflicts
Forward checking
- Idea: Keep track of remaining legal values for unassigned variables
Terminate search when any variable has no legal values
- constraint propagation
Arc-consistency (AC-3)
Arc ( X i ,X j ) is arc-consistent if for any value of X i there exist a matching (allowed) value of X j
Begin
1. For each a in Di if there is no value b in Dj that matches a then delete a from the Dj.
End.
X → Y is consistent iff
for every value x of X there is some allowed y
- detects error earlier than forward checking
• Time complexity: O(ed3)
• e = # edges, d = variable domain size)
Local search for CSPs - h(n) = min-conflicts
• Variable selection: randomly select any conflicted variable
• Value selection by min-conflicts heuristic:
– choose value that violates the fewest constraints
– i.e., hill-climb with h(n) = total number of violated constraints
WalkSAT - adds random walk to GSAT ( hill climbing )
Simulated Annealing
Theoretically, with a slow enough cooling schedule, this algorithm will find the optimal solution. But so will searching randomly.
Tree structured CSPs (eg by cutset) can be solved in linear time (O(d^C*d^2) c = cut-set size
conditioning - instantiate a variable, prune its neighbours' domain
– Variables, domains, constraints, constraint graph, solutions
• Examples:
– graph-coloring, 8-queen, cryptarithmetic, crossword puzzles, vision
problems,scheduling, design
• The search space and naive backtracking,
• The constraint graph (nodes=variables, edges=constraints, solution=assignment of value to variable such that constraint is not violated)
• Like DFS, go deep, called backtracking search
- state = assignment of values to variables while constraints are satisfied
- operator = assignment to next variable such that constraints are not violated
- goal = consistent assignment of all variables
- depends on variable ordering, so d={z,x,y} gives different tree when d={x,y,z}
Maybe:
• Consistency enforcing algorithms
– arc-consistency, AC-1,AC-3
Eg. map-coloring
variables - locations / countries / regions
values - colors in domain of red, green, blue
constraints - adjacent countries are colored differently
graph - nodes are variables (locations), edges are constraints so put an edge between two adjacent regions
Eg. 9x9 sudoku
variables - cells / squares that hold numbers, 81 variables for 9x9 problem
values - numbers in domain 1 to 9
constraints (27 constraints) -
a) each row has unique numbers ie all numbers from 1 to 9, 'Not-equal', AllDiff(a11, a12, a13, ..., a19) - 9 constraints
b) each col has unique numbers ie all numbers from 1 to 9, AllDiff(a11, a21, a22, ..., a29) - 9 constraints
c) each 3x3 grid (9 of them) sums contains all numbers from 1 to 9 - AllDiff(a11, a12, a13, a21, a22, a23, a31, a32, a33) 9 constraints
Eg. Four queen
variables - rows (x1, x2, x3, x4)
values - columns {1,2,3,4}
constraint ((4 choose 2) = 6 constraints)
- graph - (x1-x2), (x1-x3), (x1-x4), ..., (x4-x2), (x4-x3) (a box with a cross inside)
- so each variable constrains all other variables
Look-ahead schemes:
• Value ordering/pruning (choose a least restricting value),
• Variable ordering (choose the most constraining variable)
• Constraint propagation (take decision implications forward)
Heuristics:
1. Minimum Remaining Values (MRV) heuristic - choose the variable with the fewest legal values
2. Degree heuristic: MRV tie breaker, choose the variable with the most constraints on remaining variables
3. Given a variable, choose the least constraining value:
– the one that rules out the fewest values in the remaining variables
4. min-conflicts
Forward checking
- Idea: Keep track of remaining legal values for unassigned variables
Terminate search when any variable has no legal values
- constraint propagation
Arc-consistency (AC-3)
Arc ( X i ,X j ) is arc-consistent if for any value of X i there exist a matching (allowed) value of X j
Begin
1. For each a in Di if there is no value b in Dj that matches a then delete a from the Dj.
End.
X → Y is consistent iff
for every value x of X there is some allowed y
- detects error earlier than forward checking
• Time complexity: O(ed3)
• e = # edges, d = variable domain size)
Local search for CSPs - h(n) = min-conflicts
• Variable selection: randomly select any conflicted variable
• Value selection by min-conflicts heuristic:
– choose value that violates the fewest constraints
– i.e., hill-climb with h(n) = total number of violated constraints
WalkSAT - adds random walk to GSAT ( hill climbing )
Simulated Annealing
Theoretically, with a slow enough cooling schedule, this algorithm will find the optimal solution. But so will searching randomly.
Tree structured CSPs (eg by cutset) can be solved in linear time (O(d^C*d^2) c = cut-set size
conditioning - instantiate a variable, prune its neighbours' domain
VLC does not support the audio or video format "undf"
VLC does not support the audio or video format "undf". Unfortunately there is no way for you to fix this.
http://ubuntuforums.org/showthread.php?t=1117283
$ sudo apt-get install ffmpeg libavcodec-unstripped-51
http://ubuntuforums.org/showthread.php?t=1103825
$ sudo apt-get install ffmpeg ubuntu-restricted-extras
Install FFmpeg and x264 on Ubuntu Hardy Heron 8.04 LTS
http://ubuntuforums.org/showpost.php?p=6963607&postcount=360
Compiling VLC
http://wiki.videolan.org/UnixCompile
http://ubuntuforums.org/showthread.php?t=1117283
$ sudo apt-get install ffmpeg libavcodec-unstripped-51
http://ubuntuforums.org/showthread.php?t=1103825
$ sudo apt-get install ffmpeg ubuntu-restricted-extras
Install FFmpeg and x264 on Ubuntu Hardy Heron 8.04 LTS
http://ubuntuforums.org/showpost.php?p=6963607&postcount=360
Compiling VLC
http://wiki.videolan.org/UnixCompile
Tuesday, March 2, 2010
First-order-logic FOL
General rule:
Use ⇒ for ∀
Use ∧ for ∃
Every student loves some student.
∀ x ( Student(x)⇒∃ y ( Student(y)∧ Loves(x,y) ))
There is a student who is loved by every other student.
∃ x ( Student(x)∧∀ y ( Student(y)∧¬(x = y)⇒ Loves(y,x) ))
There is a student who is loved by every other student.
∃ x ( Student(x)∧∀ y ( Student(y)∧¬(x = y)⇒ Loves(y,x) ))
Bill takes either Analysis or Geometry (but not both)
Takes(Bill, Analysis)⇔¬ Takes(Bill, Geometry)
No student loves Bill.
¬∃ x ( Student(x)∧ Loves(x, Bill) )
Bill has at most one sister.
∀ x, y ( SisterOf(x, Bill)∧ SisterOf(y, Bill)⇒ x = y )
Bill has exactly one sister.
∃ x ( SisterOf(x, Bill)∧∀y ( SisterOf(y, Bill)⇒ x = y ))
Bill has at least two sisters.
∃ x, y ( SisterOf(x, Bill)∧ SisterOf(y, Bill)∧¬ (x = y) )
Only one student failed History.
∃ x ( Student(x)∧ Failed(x, History)∧∀y ( Student(y)∧ Failed(y, History)⇒ x = y ))
No student can fool all the other students.
¬∃ x ( Student(x)∧∀ y ( Student(y)∧¬ (x = y)⇒ Fools(x,y) ))
Use ⇒ for ∀
Use ∧ for ∃
Every student loves some student.
∀ x ( Student(x)⇒∃ y ( Student(y)∧ Loves(x,y) ))
There is a student who is loved by every other student.
∃ x ( Student(x)∧∀ y ( Student(y)∧¬(x = y)⇒ Loves(y,x) ))
There is a student who is loved by every other student.
∃ x ( Student(x)∧∀ y ( Student(y)∧¬(x = y)⇒ Loves(y,x) ))
Bill takes either Analysis or Geometry (but not both)
Takes(Bill, Analysis)⇔¬ Takes(Bill, Geometry)
No student loves Bill.
¬∃ x ( Student(x)∧ Loves(x, Bill) )
Bill has at most one sister.
∀ x, y ( SisterOf(x, Bill)∧ SisterOf(y, Bill)⇒ x = y )
Bill has exactly one sister.
∃ x ( SisterOf(x, Bill)∧∀y ( SisterOf(y, Bill)⇒ x = y ))
Bill has at least two sisters.
∃ x, y ( SisterOf(x, Bill)∧ SisterOf(y, Bill)∧¬ (x = y) )
Only one student failed History.
∃ x ( Student(x)∧ Failed(x, History)∧∀y ( Student(y)∧ Failed(y, History)⇒ x = y ))
No student can fool all the other students.
¬∃ x ( Student(x)∧∀ y ( Student(y)∧¬ (x = y)⇒ Fools(x,y) ))
AI references
http://sli.ics.uci.edu/Classes/2009W
http://www.cc.gatech.edu/classes/AY2003/cs4600_fall/
http://www.ics.uci.edu/~smyth/courses/cs271/schedule.html
http://www.cs.sfu.ca/~hkhosrav/personal/310.html
http://www.cs.sfu.ca/~mori/courses/cmpt310/
http://www.cs.sfu.ca/CC/310/pwfong/
http://www.cs.unb.ca/profs/hzhang/CS4725/
http://www.earlham.edu/~peters/courses/log/transtip.htm
http://pages.cs.wisc.edu/~dyer/cs540/
http://www.ics.uci.edu/~smyth/courses/cs271/schedule.html
http://www.ics.uci.edu/~welling/teaching/271fall09/
http://www.cc.gatech.edu/classes/AY2003/cs4600_fall/
http://www.ics.uci.edu/~smyth/courses/cs271/schedule.html
http://www.cs.sfu.ca/~hkhosrav/personal/310.html
http://www.cs.sfu.ca/~mori/courses/cmpt310/
http://www.cs.sfu.ca/CC/310/pwfong/
http://www.cs.unb.ca/profs/hzhang/CS4725/
http://www.earlham.edu/~peters/courses/log/transtip.htm
http://pages.cs.wisc.edu/~dyer/cs540/
http://www.ics.uci.edu/~smyth/courses/cs271/schedule.html
http://www.ics.uci.edu/~welling/teaching/271fall09/
Abscissic Acid (ABA)
Physiological effects
- promotes seed dormancy
- prevents seed germination
Seed germination is inhibited by ABA in antagonism with Gibberellin.
http://en.wikipedia.org/wiki/Abscisic_acid
- promotes seed dormancy
- prevents seed germination
Seed germination is inhibited by ABA in antagonism with Gibberellin.
http://en.wikipedia.org/wiki/Abscisic_acid
Monday, March 1, 2010
Cytokinins (CK)
Cytokinins - promotes controlled cell division
Physiological effects:
- occurs to repair leaf abscission and wounds
- leaf senescence signals expression of CKs, and so leaf senescence is prevented and plant remains green
- promotes growth of shoots (lateral bud growth), some regulation of cell division in shoot apical meristem (SAM) (pg 25)
- suppresses growth of roots
- enhance de-etiolation (greening of plants), thylakoid formation, cotyledon expansion
- limited duration
Forms:
- zeatin (found in coconut milk), some kinetin (amino-purine), biosynthetic ipt gene
Experiment:
- excised root grow indefinitely
- excised shoot grow after adding coconut milk and herring sperm DNA with auxin
- so this means, the hormone CK suppresses root growth and is needed for shoot growth
- Infection by Agrobacterium tumefaciens -> crown gall tumours
Infection by Agrobacterium tumefaciens leads to uncontrolled cell division and tumour formation 'crown gall tumours'
- baterium's cell contain a circular Ti-DNA that contains T-DNA which encodes for cytokinin and auxin, this T-DNA integrates with the host DNA during transformation and starts infecting the wound
Cytokinin oxidase metabolizes cytokinin (irreversible degradation, produces adenine + alcohol)
When CK oxidase is over-expressed
- you get REDUCED SAM (shoot apical meristem)
- and INCREASED ROOT growth
Morphogenesis in cultured plants - AUXIN / CK flux:
- low auxin, high CK => formation of shoots
- high auxin, low CK => formation of roots
- med auxin, med CK => undifferentiated
4. (2 marks) Morphogenesis of cultured plant cells
CK:
- High auxin and low CK promotes root growth
- Low auxin and high CK promotes shoot growth
- Equal concentration of auxin and CK shows no differentiation
5. (1 mark) De-etiolation of seedlings (greening)
CK:
- CK enhances de-etiolation of seedlings
- CK promotes chloroplasts development by converting etioplasts in dark-growing seedlings to thylakoids
- CK promotes cotyledon expansion
6. (5 marks) Induction of alpha-amylase production in cereal aleurone layer cells
GA: In Ca2+ independent pathway
1. GA1 binds to membrane receptor in aluerone cell
2. GA-receptor complex binds to heterotrimeric G protein initiating Ca2+ independent and Ca2+ dependent signaling pathway
3. In Ca2+ independent pathway, the Ca2+ activates the F-protein, the F-protein diffuses to the nucleus
4. the SCF-ubiquitin ligase complex degrades the DELLA repressor
5. GAMYB gene is expressed and it binds to the alpha-amylase hydrolytic enzyme promoter
6. alpha-amylase enzymes are expressed and secreted from the aleurone cell for starch degradation in endosperm
Physiological effects:
- occurs to repair leaf abscission and wounds
- leaf senescence signals expression of CKs, and so leaf senescence is prevented and plant remains green
- promotes growth of shoots (lateral bud growth), some regulation of cell division in shoot apical meristem (SAM) (pg 25)
- suppresses growth of roots
- enhance de-etiolation (greening of plants), thylakoid formation, cotyledon expansion
- limited duration
Forms:
- zeatin (found in coconut milk), some kinetin (amino-purine), biosynthetic ipt gene
Experiment:
- excised root grow indefinitely
- excised shoot grow after adding coconut milk and herring sperm DNA with auxin
- so this means, the hormone CK suppresses root growth and is needed for shoot growth
- Infection by Agrobacterium tumefaciens -> crown gall tumours
Infection by Agrobacterium tumefaciens leads to uncontrolled cell division and tumour formation 'crown gall tumours'
- baterium's cell contain a circular Ti-DNA that contains T-DNA which encodes for cytokinin and auxin, this T-DNA integrates with the host DNA during transformation and starts infecting the wound
Cytokinin oxidase metabolizes cytokinin (irreversible degradation, produces adenine + alcohol)
When CK oxidase is over-expressed
- you get REDUCED SAM (shoot apical meristem)
- and INCREASED ROOT growth
Morphogenesis in cultured plants - AUXIN / CK flux:
- low auxin, high CK => formation of shoots
- high auxin, low CK => formation of roots
- med auxin, med CK => undifferentiated
4. (2 marks) Morphogenesis of cultured plant cells
CK:
- High auxin and low CK promotes root growth
- Low auxin and high CK promotes shoot growth
- Equal concentration of auxin and CK shows no differentiation
5. (1 mark) De-etiolation of seedlings (greening)
CK:
- CK enhances de-etiolation of seedlings
- CK promotes chloroplasts development by converting etioplasts in dark-growing seedlings to thylakoids
- CK promotes cotyledon expansion
6. (5 marks) Induction of alpha-amylase production in cereal aleurone layer cells
GA: In Ca2+ independent pathway
1. GA1 binds to membrane receptor in aluerone cell
2. GA-receptor complex binds to heterotrimeric G protein initiating Ca2+ independent and Ca2+ dependent signaling pathway
3. In Ca2+ independent pathway, the Ca2+ activates the F-protein, the F-protein diffuses to the nucleus
4. the SCF-ubiquitin ligase complex degrades the DELLA repressor
5. GAMYB gene is expressed and it binds to the alpha-amylase hydrolytic enzyme promoter
6. alpha-amylase enzymes are expressed and secreted from the aleurone cell for starch degradation in endosperm
Gibberellins (GA)
http://universe-review.ca/I10-22a-anatomy2.jpg

http://media-1.web.britannica.com/eb-media/97/5597-003-9A3253A5.gif
Gibberellins - promotes internode (between nodes) elongation
Gibberellins Physiological Effects
- promotes internode elongation (creating taller plants vs rosette/dwarf plants - cabbage, dandelions lack GA)
- promotes juvenile to mature stages eg. cone buds in conifers
- sex determination eg. +GA prevent anther development in corn
- promotes seed germination via reserve mobilization (alpha-amylase production) and phytochrome induced transcription of genes
- anatagonistic to ABA (Abscisic acid)
- GA biosynthesis occurs throughout the entire life cycle
Forms:
- GA1 (active form, has COOH at C6 and beta-OH at C3) encodes CPS, the first enzyme in GA biosynthesis
- GA3 commercial form
- mostly inactive form
- GA20 + OH + GA-3beta-hydrolase => GA1
Reserve mobilization by GA
1. GA secreted in embryo
2. GA reaches aleurone layer via scutellum
3. Aleurone layer secretes alpha-amylase (starch hydrolase)
4. Starch is broken down to simple sugars and is transported back to the embryo
Experiment:
- 5'GA1-GUS reporter show sites of GA biosynthesis
- GA1 encodes CPS, the first committed enzyme in GA biosynthesis.
Commercial applications of GA:
- increases stalk length that offsets fruit compaction
- promotes fruit development without pollination (parthenocarpy = virgin/seedless fruit)
- beer, GA promotes malting (start germination by water then quickly halt it by heat then development of color and flavour is produced by kilning) of barley
- sugar - GA increase sugar yield and internode length
- hasten cone production
Commercial applications of GA Inhibitors:
- ornaments - crysanthemums (sprayed with GA inhibitor, reduces internode elongation so they are small)
- prevents lodging (bending of stems to ground) by reducing stem length

GA induces alpha-amylase production via Ca2+ independent pathway.
1. GA binds to receptor
2. GA-receptor binds to G-protein
3. G-protein activates F-box protein
4. F-box protein binds to DELLA-domain repressor (which is degraded by SCF-ubiquitin ligase)
5. GAMYB gene expression is activated
6. GAMYB activates alpha-amylase expression
1. (1 mark) Reproduction in conifers
GA:
Influence the transition from juvenile to
mature stages e.g. induction of cone-
buds in conifers
2. (2 marks) Seed germination
GA:
- Promotes post-germinative mobilization of reserves in cereal
grains
- promotes light-sensitive germination mediated by phytochromes which are induced by transcription of genes encoding GA biosynthetic enzymes
3. (3 marks) Control of root growth
CK:
- CK suppresses root growth so plants that are CK deficient show root growth compared to wild-types
- CK suppresses the size and rate of cell division activity of roots
- bell-shaped curve (X axis = CK signaling, Y axis = Root growth rate):
a) wild-type shows supraoptimal levels of CK
b) Over-expression of CK oxidase decreases CK signaling concentration to optimum level and root growth occurs
c) Further decreasing CK signaling below the optimum amount causes decrease in root growth

http://media-1.web.britannica.com/eb-media/97/5597-003-9A3253A5.gif
Gibberellins - promotes internode (between nodes) elongation
Gibberellins Physiological Effects
- promotes internode elongation (creating taller plants vs rosette/dwarf plants - cabbage, dandelions lack GA)
- promotes juvenile to mature stages eg. cone buds in conifers
- sex determination eg. +GA prevent anther development in corn
- promotes seed germination via reserve mobilization (alpha-amylase production) and phytochrome induced transcription of genes
- anatagonistic to ABA (Abscisic acid)
- GA biosynthesis occurs throughout the entire life cycle
Forms:
- GA1 (active form, has COOH at C6 and beta-OH at C3) encodes CPS, the first enzyme in GA biosynthesis
- GA3 commercial form
- mostly inactive form
- GA20 + OH + GA-3beta-hydrolase => GA1
Reserve mobilization by GA
1. GA secreted in embryo
2. GA reaches aleurone layer via scutellum
3. Aleurone layer secretes alpha-amylase (starch hydrolase)
4. Starch is broken down to simple sugars and is transported back to the embryo
Experiment:
- 5'GA1-GUS reporter show sites of GA biosynthesis
- GA1 encodes CPS, the first committed enzyme in GA biosynthesis.
Commercial applications of GA:
- increases stalk length that offsets fruit compaction
- promotes fruit development without pollination (parthenocarpy = virgin/seedless fruit)
- beer, GA promotes malting (start germination by water then quickly halt it by heat then development of color and flavour is produced by kilning) of barley
- sugar - GA increase sugar yield and internode length
- hasten cone production
Commercial applications of GA Inhibitors:
- ornaments - crysanthemums (sprayed with GA inhibitor, reduces internode elongation so they are small)
- prevents lodging (bending of stems to ground) by reducing stem length

GA induces alpha-amylase production via Ca2+ independent pathway.
1. GA binds to receptor
2. GA-receptor binds to G-protein
3. G-protein activates F-box protein
4. F-box protein binds to DELLA-domain repressor (which is degraded by SCF-ubiquitin ligase)
5. GAMYB gene expression is activated
6. GAMYB activates alpha-amylase expression
1. (1 mark) Reproduction in conifers
GA:
Influence the transition from juvenile to
mature stages e.g. induction of cone-
buds in conifers
2. (2 marks) Seed germination
GA:
- Promotes post-germinative mobilization of reserves in cereal
grains
- promotes light-sensitive germination mediated by phytochromes which are induced by transcription of genes encoding GA biosynthetic enzymes
3. (3 marks) Control of root growth
CK:
- CK suppresses root growth so plants that are CK deficient show root growth compared to wild-types
- CK suppresses the size and rate of cell division activity of roots
- bell-shaped curve (X axis = CK signaling, Y axis = Root growth rate):
a) wild-type shows supraoptimal levels of CK
b) Over-expression of CK oxidase decreases CK signaling concentration to optimum level and root growth occurs
c) Further decreasing CK signaling below the optimum amount causes decrease in root growth
Subscribe to:
Posts (Atom)
+(20).jpg)



